Protein
- Protein accession
- 3aEnM [EnVhog]
- Representative
- 6dOqy
- Source
- EnVhog (cluster: phalp2_33305)
- Protein name
- 3aEnM
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
VANNAPEQLKTLTTPQNTPQAANSEVVIGTGACDIVKNYSWDVKIAYAVCMAESGGNPNAANLNDRHNGCVGSYGLMQIACIHGGIFTDPKQNMDKAFEIYNRSGWKPWGAYTNGSYLRYI
- Physico‐chemical
properties -
protein length: 121 AA molecular weight: 13133,6 Da isoelectric point: 6,87 hydropathy: -0,37
Representative Protein Details
- Accession
- 6dOqy
- Protein name
- 6dOqy
- Sequence length
- 106 AA
- Molecular weight
- 12069,61150 Da
- Isoelectric point
- 9,30139
- Sequence
-
VKGCEQYRQLIAKYDWDVDLMMAIMRAESGCNPVADNTGLNRDGSNDKGLLQINSIHKNLISDLDRLNPEKNIAVGYRIWKSQGYRAWSAYNNGSYKKFLKQGVVK
Other Proteins in cluster: phalp2_33305
| Total (incl. this protein): 114 | Avg length: 115,6 | Avg pI: 7,31 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 6dOqy | 106 | 9,30139 |
| 11gbO | 142 | 4,41857 |
| 18VG2 | 123 | 5,49471 |
| 1IXub | 88 | 9,27070 |
| 1Jf9K | 83 | 5,44963 |
| 1Lw6n | 97 | 5,66005 |
| 1M4oL | 111 | 5,54711 |
| 1MeNv | 109 | 6,89203 |
| 1Mw9Q | 109 | 6,39873 |
| 1P0JZ | 84 | 7,73615 |
| 1cvVH | 129 | 7,81075 |
| 1egtT | 122 | 6,88334 |
| 1gxnP | 118 | 4,48064 |
| 1l5FT | 118 | 5,60935 |
| 1lnZB | 109 | 6,39680 |
| 1ltLD | 126 | 4,75881 |
| 1nDRe | 160 | 8,47761 |
| 1zUgg | 138 | 6,58266 |
| 21vhK | 117 | 5,80482 |
| 23Sw8 | 82 | 4,70578 |
| 23zFK | 82 | 8,84289 |
| 2Pavl | 125 | 4,88516 |
| 2dXuK | 106 | 4,54140 |
| 2gnmX | 115 | 8,32508 |
| 2j1fz | 117 | 8,83773 |
| 32ZAz | 123 | 4,62825 |
| 32wq | 136 | 6,05480 |
| 332vR | 124 | 8,36576 |
| 37Q0H | 136 | 5,88451 |
| 38hFu | 114 | 5,35858 |
| 3EbdO | 151 | 4,87732 |
| 3NSOX | 179 | 8,75714 |
| 3OMfb | 123 | 8,74122 |
| 3T9Ky | 123 | 9,29990 |
| 3ZBSh | 97 | 5,18652 |
| 3ZGgC | 106 | 4,79928 |
| 3aB3C | 121 | 6,05144 |
| 3bv4P | 125 | 5,71649 |
| 3bxSq | 121 | 6,87027 |
| 3ggiM | 81 | 9,32427 |
| 3itRH | 82 | 4,85527 |
| 3lxdL | 154 | 6,27101 |
| 3zzSP | 109 | 6,39691 |
| 40HMb | 81 | 6,69657 |
| 40pv5 | 133 | 5,76844 |
| 4Agsg | 127 | 4,95007 |
| 4HC4G | 150 | 8,47561 |
| 4IDBl | 152 | 8,36305 |
| 4Ncs6 | 125 | 6,07844 |
| 4fdSN | 119 | 5,22597 |
| 4gQsE | 109 | 5,51022 |
| 4kTME | 114 | 8,50817 |
| 4v6iK | 111 | 5,54711 |
| 5Eig2 | 106 | 9,03481 |
| 5RVAZ | 127 | 9,44425 |
| 5Rpoi | 105 | 5,74946 |
| 5YTSJ | 129 | 8,67959 |
| 5ZNYV | 99 | 8,46304 |
| 5ffiw | 104 | 6,39430 |
| 5nX3 | 81 | 9,05112 |
| 65ncG | 129 | 7,79979 |
| 68uy3 | 129 | 8,70106 |
| 6JMd | 102 | 8,85456 |
| 6TZLQ | 107 | 4,61740 |
| 6UbTy | 125 | 6,97280 |
| 6VFzv | 109 | 9,17683 |
| 6Wh8a | 112 | 4,57585 |
| 6Ydlz | 129 | 9,27682 |
| 6Yk4C | 129 | 9,27650 |
| 6ZRgK | 122 | 9,48054 |
| 6hkqc | 129 | 8,36447 |
| 6jpFH | 99 | 8,47645 |
| 6lLy6 | 99 | 8,47645 |
| 6r6lx | 129 | 8,68778 |
| 6sqAl | 81 | 8,50514 |
| 6tmUy | 110 | 8,35763 |
| 6tvgy | 129 | 8,68868 |
| 70XJp | 129 | 9,11862 |
| 70iSF | 105 | 7,82435 |
| 713ba | 129 | 8,93288 |
| 71r6E | 97 | 8,91193 |
| 7MbMw | 129 | 9,07923 |
| 7NKVM | 78 | 9,16723 |
| 7UOIL | 129 | 8,91283 |
| 7ZU89 | 121 | 5,18971 |
| 7ZurU | 107 | 4,67889 |
| 82Zlc | 100 | 6,81735 |
| 84UBH | 88 | 6,15813 |
| 87F8L | 83 | 5,53432 |
| 89wRK | 123 | 5,75417 |
| 8dv5k | 110 | 8,36769 |
| 8hACo | 187 | 6,39668 |
| 8jaj5 | 129 | 6,40208 |
| 8lZgk | 150 | 5,10792 |
| 8ly8L | 81 | 8,82432 |
| 8qWSp | 129 | 8,92869 |
| BuvR | 129 | 8,66431 |
| ES8H | 105 | 8,74109 |
| HkzN | 129 | 9,30087 |
| K2qv | 129 | 9,11862 |
| NfZc | 129 | 9,25413 |
| OAe6 | 105 | 8,74128 |
| OHZC | 105 | 8,39341 |
| Oqia | 105 | 8,98491 |
| e7cK | 94 | 6,48774 |
| oHu0 | 110 | 8,39490 |
| oSii | 99 | 8,49953 |
| rk8i | 79 | 8,85198 |
| t5uY | 109 | 6,39231 |
| wIl2 | 110 | 8,95055 |
| ygix | 105 | 8,39348 |
| A0A8S5SLJ3 | 115 | 8,95023 |
| A0A8S5THU2 | 138 | 9,19791 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_14404
4wK5S
|
1 | 40,6% | 96 | 1.566E-25 |
| 2 |
phalp2_13792
6WqfF
|
41 | 44,3% | 79 | 1.803E-23 |
| 3 |
phalp2_26683
2CQZE
|
7 | 36,4% | 96 | 2.267E-22 |
| 4 |
phalp2_28236
t2PU
|
13 | 40,9% | 83 | 8.039E-22 |
| 5 |
phalp2_19174
1XGro
|
3 | 35,2% | 105 | 9.258E-20 |
| 6 |
phalp2_5240
852fn
|
20 | 35,7% | 95 | 1.270E-19 |
| 7 |
phalp2_14996
ECkt
|
4 | 36,0% | 86 | 1.743E-19 |
| 8 |
phalp2_32782
2lJ4Z
|
1 | 31,6% | 98 | 1.066E-17 |
| 9 |
phalp2_19507
3iTHv
|
6 | 28,8% | 97 | 2.753E-17 |
| 10 |
phalp2_31752
3ZMVn
|
13 | 35,6% | 73 | 3.778E-17 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(6dOqy)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50