Protein
- Protein accession
- 3VHZ8 [EnVhog]
- Representative
- 676qm
- Source
- EnVhog (cluster: phalp2_23405)
- Protein name
- 3VHZ8
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MAKPKIVYEDIRAKKISYGSLRDRKKVRYIVIHYTGNKGDTARGNGLFFKNGNKRSAGAHYFVDAEGKIIRSIPMNRPAWSVGGFFTKEGAAGTYYLSCTNANSVSIEMCNYTKGYISAKQEAAVKQLVKYIQYYCPNASTIIRHWDVNGKSCPAPMASKGNSKWRKLLKAIKG
- Physico‐chemical
properties -
protein length: 174 AA molecular weight: 19432,3 Da isoelectric point: 9,99 hydropathy: -0,48
Representative Protein Details
- Accession
- 676qm
- Protein name
- 676qm
- Sequence length
- 150 AA
- Molecular weight
- 17031,35560 Da
- Isoelectric point
- 9,71940
- Sequence
-
MEIKKRRAKSISYGSKRSLKGIKYIVIHFTGNKGDTAKNNADFYATGNTREAGAHFFVDKKSEIWESVPMEYTAWAVGHFFTRKNGAASYYKKCTNDNSVSIELCDCKKGVSWEQMLAVRELVQYIQKRCPNAKLSLDIGMSTAKRVQSR
Other Proteins in cluster: phalp2_23405
| Total (incl. this protein): 129 | Avg length: 170,1 | Avg pI: 9,78 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 676qm | 150 | 9,71940 |
| 13vz0 | 176 | 9,14428 |
| 1ks7y | 172 | 9,93711 |
| 1ktVx | 168 | 9,96863 |
| 21m6V | 175 | 9,18392 |
| 21moc | 175 | 9,26548 |
| 21ogJ | 175 | 9,34335 |
| 23QHM | 172 | 9,68884 |
| 23aHX | 175 | 9,25826 |
| 23aij | 168 | 9,79979 |
| 23sVs | 169 | 10,09364 |
| 24EbE | 173 | 9,90055 |
| 2t6I | 160 | 9,92286 |
| 3B3SP | 172 | 9,92002 |
| 3ITnx | 172 | 9,76272 |
| 3TKOg | 178 | 9,42736 |
| 3TOp4 | 167 | 9,55720 |
| 3TPdr | 167 | 9,98643 |
| 3TRaL | 178 | 9,57628 |
| 3VGoM | 168 | 9,72249 |
| 3VHSr | 172 | 9,87999 |
| 3VI5B | 169 | 9,49434 |
| 3VLv3 | 180 | 9,37765 |
| 3WA8H | 169 | 9,63359 |
| 3WGZ5 | 171 | 9,81823 |
| 3WJLe | 169 | 9,81604 |
| 3WM65 | 172 | 9,57563 |
| 3WNdp | 174 | 9,83750 |
| 3Wyi7 | 182 | 9,67930 |
| 3WzEm | 171 | 9,94336 |
| 3ieOu | 233 | 9,88502 |
| 3lSdB | 171 | 9,92918 |
| 3lbSo | 168 | 9,96818 |
| 3lh1q | 174 | 9,94845 |
| 3lmkI | 173 | 9,88515 |
| 3nxtV | 172 | 9,77523 |
| 3shmM | 172 | 9,82397 |
| 3tcCx | 167 | 10,07069 |
| 3tzBA | 173 | 9,85968 |
| 3ukp3 | 171 | 9,80559 |
| 3vDJp | 171 | 9,85375 |
| 3vT9X | 172 | 9,76266 |
| 3wMDz | 172 | 9,84144 |
| 3wj9Y | 169 | 9,81384 |
| 419Av | 177 | 9,22254 |
| 41e9C | 184 | 9,91396 |
| 41obj | 174 | 10,01370 |
| 41pRL | 173 | 9,26967 |
| 4L7p0 | 183 | 9,74867 |
| 4VOut | 160 | 9,96908 |
| 5JXot | 174 | 9,99126 |
| 5KE7k | 172 | 9,84692 |
| 5M1Rl | 169 | 9,79360 |
| 5MJIL | 168 | 9,67060 |
| 5MiIO | 179 | 9,88579 |
| 5OMew | 172 | 9,89869 |
| 5P2df | 165 | 9,88115 |
| 5PE6F | 160 | 9,91828 |
| 5QgK0 | 172 | 9,78709 |
| 5QllE | 134 | 9,88051 |
| 5RLJm | 174 | 10,01254 |
| 5RrGy | 165 | 9,76891 |
| 5Tb3B | 168 | 9,83067 |
| 5UYnU | 168 | 9,62760 |
| 5UfWO | 165 | 9,89482 |
| 5UlGE | 168 | 9,74635 |
| 5WTlC | 174 | 9,90520 |
| 5X29P | 172 | 9,75511 |
| 5YP7D | 174 | 9,97063 |
| 5YT42 | 172 | 9,80804 |
| 5ZVOF | 172 | 9,73055 |
| 614Yn | 172 | 9,91964 |
| 61pon | 172 | 9,85968 |
| 62qnu | 168 | 9,76382 |
| 62sHA | 149 | 9,88366 |
| 64xB5 | 169 | 9,71269 |
| 66K9e | 160 | 9,86671 |
| 66U1v | 168 | 9,76382 |
| 66xRC | 172 | 9,82364 |
| 66y8A | 167 | 9,60709 |
| 67yC4 | 172 | 9,76272 |
| 68iBx | 174 | 10,07662 |
| 6Z8hI | 172 | 9,76266 |
| 6a6Hn | 183 | 9,87161 |
| 6aZ3E | 174 | 9,99088 |
| 6bp62 | 174 | 9,96870 |
| 6bwmv | 172 | 9,89907 |
| 6d0gL | 152 | 9,79173 |
| 6ec2p | 172 | 9,78561 |
| 6g9Dz | 172 | 9,84943 |
| 6gazu | 169 | 9,97411 |
| 6giZL | 172 | 9,86368 |
| 6hL32 | 161 | 9,83892 |
| 6hiYn | 170 | 9,73087 |
| 6ieMK | 171 | 9,92918 |
| 6jS6h | 172 | 9,76266 |
| 6ja5O | 172 | 9,76272 |
| 6ke65 | 168 | 9,76382 |
| 6mt0x | 169 | 9,90004 |
| 6n8vf | 174 | 10,01254 |
| 6nIxc | 169 | 9,89404 |
| 6nKTJ | 174 | 9,93214 |
| 6o7PB | 161 | 9,86046 |
| 6p9Bj | 174 | 9,99126 |
| 6qs9o | 170 | 9,73087 |
| 6r7DB | 172 | 9,75511 |
| 6rB88 | 174 | 9,99088 |
| 6srf0 | 171 | 9,92918 |
| 6t31u | 172 | 9,82364 |
| 6v0Pt | 175 | 8,12123 |
| 6vYH9 | 125 | 9,85143 |
| 6vYVr | 160 | 9,96908 |
| 6weaD | 170 | 9,71353 |
| 6wt2y | 172 | 9,84144 |
| 7Xuwn | 160 | 9,89566 |
| 7wb6x | 171 | 8,64574 |
| 82Goc | 177 | 9,57905 |
| 834Gk | 169 | 9,62224 |
| 85yt8 | 160 | 9,94555 |
| 8cEsy | 168 | 9,73197 |
| 8eYJi | 172 | 9,85968 |
| 8lb6U | 174 | 9,97018 |
| 8oT8r | 173 | 9,76852 |
| 8okPn | 172 | 9,79708 |
| 8tJE6 | 124 | 9,60065 |
| DwWI | 168 | 9,94472 |
| Ouw6 | 168 | 9,89527 |
| A0A8S5MB25 | 172 | 9,82364 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_38675
83KqQ
|
128 | 56,2% | 135 | 9.935E-48 |
| 2 |
phalp2_38069
6uYUB
|
10 | 45,7% | 107 | 3.051E-29 |
| 3 |
phalp2_14283
3qOze
|
23 | 44,0% | 93 | 1.107E-22 |
| 4 |
phalp2_20835
6rXam
|
1 | 41,4% | 94 | 2.847E-19 |
| 5 |
phalp2_30401
4NIg7
|
17 | 45,7% | 105 | 3.501E-18 |
| 6 |
phalp2_11551
100RI
|
7 | 25,5% | 141 | 1.679E-17 |
| 7 |
phalp2_24292
3k9WX
|
42 | 33,0% | 130 | 1.463E-13 |
| 8 |
phalp2_31879
4GdWf
|
8 | 31,7% | 104 | 2.730E-13 |
| 9 |
phalp2_25288
86peP
|
187 | 30,2% | 119 | 1.150E-11 |
| 10 |
phalp2_35735
47Q1t
|
51 | 31,7% | 145 | 2.260E-09 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(676qm)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50