Protein

Protein accession
3PUX1 [EnVhog]
Representative
3o77A
Source
EnVhog (cluster: phalp2_31447)
Protein name
3PUX1
Lysin probability
98%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MDRILCVILCVVLVVFSIWILAYCCKPNVETVVEVTTQPTTEETTAEPVETEAPTTAPTEPPVTEPPIALYDVPLDAELQLHIISEADEHGIDPAIIMAMARKESTYRADAIGDGGNSYGLLQVQPRWHRERMKKFGCNDKEDLLDPYQNVTVAVDYLCELLNRHGSIDRALTAYNQGHYNGTVTRYAKTVLAYAEQIKNERSQS
Physico‐chemical
properties
protein length:205 AA
molecular weight:22911,7 Da
isoelectric point:4,73
hydropathy:-0,23
Representative Protein Details
Accession
3o77A
Protein name
3o77A
Sequence length
179 AA
Molecular weight
19885,19240 Da
Isoelectric point
4,34025
Sequence
VIDRKICIAALACATAACMIATHCTYAEPQVEQDEPQVEQTVEVEQETLYDVPLDADLQKHIVETCEAHHIDPTIVLAMIYRESSYNAEAIGDGGDSYGLMQIQPRWHYERMERLGCTDLLNPYQNVTVGVEIFADQLARYDGDIAKALVAYNQGSFKETVTDYALAVLEVAAELAVKQ
Other Proteins in cluster: phalp2_31447
Total (incl. this protein): 181 Avg length: 175,5 Avg pI: 4,96

Protein ID Length (AA) pI
3o77A 179 4,34025
11rXc 159 4,83975
11tnq 162 4,79780
11uSX 162 4,53026
1cBBm 189 4,59762
1cwUf 162 5,03738
1cy3M 163 4,83077
1gB5M 188 4,90165
1kIlQ 162 4,91540
1kJ5U 159 4,97758
1ktKr 207 5,07472
1lHce 162 4,59779
2XPGr 197 7,99938
2bfYk 168 5,38682
2oAG7 176 4,27983
3PCAn 202 4,05014
3PTjC 273 4,67321
3Pw5Y 193 4,81866
3Q56t 199 4,08959
3TPt4 192 5,12565
3VKeU 191 4,95297
3c6fR 162 4,79780
3c6wU 166 4,84106
3cfri 162 4,89994
3gb1e 193 4,18104
3ii8G 171 4,05003
3mrvr 187 4,44443
3nWgk 196 4,85959
3nxbL 187 4,38799
3tR9D 207 4,87829
45voV 178 4,05003
5BVk 187 4,28335
5KE0u 162 4,63467
5KIlZ 162 4,96224
5L2Ty 160 5,25649
5MVpu 206 4,25908
5NSG1 158 5,03738
5OWGY 162 4,63467
5OXSo 166 4,83304
5OYaa 187 4,35480
5PVua 205 4,84634
5Pgek 158 5,22375
5PiOE 159 4,83924
5U2qX 158 4,94854
5UWRl 163 4,97940
5VGI3 162 4,71084
5XmPF 162 4,85532
5XnVv 205 4,84634
5XzmR 160 5,32191
5Ynow 162 4,68492
5YvAX 166 4,76484
5Z4BI 168 4,71630
5Z9rc 174 6,31239
5ZRpk 162 6,16313
5ZSOR 159 5,18243
60GHW 158 5,69597
60yyy 166 4,68589
61RG1 162 4,51133
62gsT 162 4,79780
63469 206 4,20895
63ZhX 206 4,25908
63s2b 160 5,39717
64ZB2 162 4,91540
65jtM 174 8,57276
664JD 159 5,42724
67lg3 159 4,82275
68K2l 160 5,76782
68tB8 160 5,76782
68xzJ 162 5,22284
69BtJ 158 5,19192
6YfLt 162 4,79780
6YqgX 174 5,75588
6Ysxx 162 4,69328
6aFLP 160 5,76765
6aU52 162 4,94473
6bs5D 173 4,70157
6dFjc 215 4,46348
6ek7R 162 4,54754
6f5hD 158 5,18908
6gMSI 200 4,33974
6icor 163 4,83077
6ie3u 217 4,30268
6iiYg 162 5,49596
6jwBh 175 5,83915
6k9MA 186 4,38373
6kCbS 166 4,74045
6kRry 160 5,31026
6l7o7 153 4,26033
6m4ps 202 4,38328
6mVMk 174 5,66244
6mh6W 163 4,95172
6oxVs 162 4,63467
6paKX 158 4,90807
6pcsX 158 5,59508
6q3im 197 4,89062
6qPYe 160 5,76782
6qdlt 184 4,38373
6qmnB 187 4,34150
6rzUA 185 4,40129
6tMCl 162 4,69328
6tmzA 187 4,39942
6x0Q 199 4,45296
70VxJ 159 4,77370
70Yni 162 4,63467
70gE4 174 6,74874
70iVq 162 4,59779
70jsr 160 5,50420
70nrG 162 4,82372
70t9e 162 4,72817
70zBP 174 8,57276
74wJ 196 4,79951
79wOJ 182 4,20725
7MiY1 160 5,29770
7VqD9 215 4,33127
7YB9m 206 4,45108
7YX46 206 4,38981
7aLjA 193 4,18775
7qcgW 213 4,50275
800B6 253 4,55391
82SMa 190 4,51185
84yQ4 161 5,44702
86fU5 201 4,81122
86snP 196 4,44915
88FMq 184 8,41391
8f4dX 187 4,35480
8hhxd 166 4,84106
8mXiJ 162 5,77651
8mqEy 229 4,71715
8n59M 214 4,33860
8pFKU 215 4,30842
8pFgI 229 4,85072
8pVnS 207 4,80513
8qQJx 186 4,24726
8s1uD 216 4,35582
8teSu 162 4,69328
8trd5 187 4,41448
A56U 162 4,79780
BFpI 162 4,60148
CU0J 162 4,72817
DSFC 185 6,43511
DTkD 162 4,63467
ERr6 162 4,63467
F0Sj 174 5,47777
HBcE 162 4,82372
Husc 174 6,74874
JU56 158 4,84702
JVOL 162 4,72306
K9Ce 162 4,72817
KK69 162 4,93621
KOJq 162 4,69822
KOSd 159 5,22375
NDP2 175 5,66249
NeAd 175 6,42942
NnvS 162 4,72306
Nqmy 162 4,93621
NsjB 162 4,81502
O4Qz 162 4,72817
OIGw 162 4,88204
OQUT 162 4,83975
m20k 196 4,47337
nlOD 190 4,62410
nmPH 208 4,69652
oLzP 162 4,79780
oMlV 162 4,93217
p4gf 162 4,69328
p5kJ 162 4,76887
pMK5 127 4,91705
qIVZ 159 4,74466
qgV5 184 6,15404
rnVg 162 4,69328
wOOG 162 4,79780
wOPT 162 5,05261
wPpj 162 5,19192
xl9i 162 4,51133
xlFo 162 4,91540
xlur 162 4,79780
xqnD 184 7,69125
xzUS 160 5,45054
yjoJ 162 4,89176
yovg 162 4,51133
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_16046
3Q4hp
22 54,1% 155 6.727E-57
2 phalp2_31682
3e47a
166 42,7% 152 2.004E-51
3 phalp2_600
139Z6
763 41,3% 196 5.934E-46
4 phalp2_4037
19be8
11 51,1% 127 1.526E-45
5 phalp2_38604
24Hma
11 39,2% 176 5.377E-45
6 phalp2_12998
3nWhM
100 38,4% 138 5.469E-42
7 phalp2_36276
81fJ
27 36,7% 158 8.547E-34
8 phalp2_23796
1djCg
437 38,6% 132 1.300E-31
9 phalp2_27606
5N2Yb
18 42,1% 140 2.436E-31
10 phalp2_980
2m07J
181 31,7% 170 6.247E-31

Domains

Domains
Disordered region
SLT
Representative sequence (used for alignment): 3o77A (179 AA)
Member sequence: 3PUX1 (205 AA)
1 179 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01464

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (3o77A) rather than this protein.
PDB ID
3o77A
Method AlphaFoldv2
Resolution 84.21
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50