Protein
- Protein accession
- 3P4ns [EnVhog]
- Representative
- 80F6A
- Source
- EnVhog (cluster: phalp2_9780)
- Protein name
- 3P4ns
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 97% (predicted by ML model) - Protein sequence
-
MKKLIDQLKLQEGLRLKPYECTSGKLSIGVGRNLEDIGISEKEAEMLLLHDIEEAERQLAAHFPWTQDLDEVRLAALINFTFNVGIGTVSKFVNAMALLKEGNFDMASEEFLQSRWANQVGQRAIDVTEQIRTGEWQ
- Physico‐chemical
properties -
protein length: 137 AA molecular weight: 15535,5 Da isoelectric point: 4,86 hydropathy: -0,27
Representative Protein Details
- Accession
- 80F6A
- Protein name
- 80F6A
- Sequence length
- 193 AA
- Molecular weight
- 22426,57290 Da
- Isoelectric point
- 7,70233
- Sequence
-
MDIGFNINRGDIGSVLGTFVEKIDDGWFKVGGVKVKCYTSNSGLLKNEITWDEHYEMNYTKIKDQLIKHEGLRLKPYKCTAGKLTIGVGRNLDDVGISEHEALDMLFNDIGKCMNDLREIFQQFDQFPENIQLVLVDMRFHLGPNRFRAFRAMIRAVDDRDWSEMIRQMKNSAWYLQVKNRANNLIEMVKNAK
Other Proteins in cluster: phalp2_9780
| Total (incl. this protein): 154 | Avg length: 145,9 | Avg pI: 6,47 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 80F6A | 193 | 7,70233 |
| 13KCg | 137 | 5,21170 |
| 13OKz | 145 | 4,88533 |
| 140Hb | 137 | 4,87203 |
| 16uCQ | 141 | 5,49186 |
| 1BIS2 | 188 | 6,75136 |
| 1Ctjx | 140 | 8,39290 |
| 1GDaT | 137 | 5,21204 |
| 1OYmR | 146 | 8,92753 |
| 1PPF | 140 | 9,24994 |
| 1TRbF | 147 | 5,47646 |
| 1W0Zh | 137 | 5,84483 |
| 1bbtl | 139 | 6,90943 |
| 1egMO | 137 | 5,04164 |
| 1kuf0 | 136 | 5,70637 |
| 1mCgU | 179 | 6,60466 |
| 1muKc | 139 | 6,05923 |
| 1pPB0 | 151 | 8,52815 |
| 1qGeW | 140 | 6,30870 |
| 1rE5j | 136 | 4,92774 |
| 1sATK | 137 | 5,09888 |
| 1u7MC | 137 | 6,30858 |
| 1uBMz | 137 | 5,43105 |
| 1vib0 | 140 | 5,45316 |
| 1vvll | 136 | 5,07535 |
| 1wt8y | 139 | 5,11144 |
| 1yORR | 136 | 4,82321 |
| 20ZEu | 137 | 4,97792 |
| 21WWz | 154 | 5,26246 |
| 224h8 | 137 | 5,44457 |
| 22gmy | 137 | 4,96167 |
| 2A4Qx | 157 | 9,29906 |
| 2BbEF | 144 | 7,83292 |
| 2Bpqv | 143 | 7,07324 |
| 2ChY5 | 142 | 7,87902 |
| 2J4Q7 | 136 | 4,94496 |
| 2PhPQ | 139 | 5,38972 |
| 2Rg8Y | 136 | 5,07228 |
| 2V6yX | 149 | 10,06766 |
| 2aYIU | 151 | 8,59694 |
| 2akge | 218 | 4,65929 |
| 2eCE8 | 136 | 4,92984 |
| 2nLo9 | 139 | 5,20647 |
| 2nazM | 120 | 5,47885 |
| 2q9zN | 139 | 5,56962 |
| 2qUtM | 137 | 5,22608 |
| 2rGab | 142 | 6,21980 |
| 2sGja | 157 | 9,25851 |
| 2sPa0 | 157 | 9,29906 |
| 2t8lz | 156 | 9,13480 |
| 2tkKA | 155 | 9,17483 |
| 2uAzG | 207 | 5,45361 |
| 2wg4e | 137 | 4,75011 |
| 2wxFk | 146 | 7,07699 |
| 2xIkR | 152 | 4,96275 |
| 34Ony | 140 | 7,65152 |
| 3JqD3 | 149 | 8,73129 |
| 3Kb0C | 152 | 4,88130 |
| 3QKyB | 160 | 6,13892 |
| 3RJrn | 137 | 4,79172 |
| 3Rc2f | 139 | 6,12846 |
| 3RqAt | 106 | 5,16169 |
| 3T4bT | 143 | 7,83415 |
| 3USOw | 143 | 9,12764 |
| 3mEqt | 205 | 5,06568 |
| 3rAbi | 139 | 5,25206 |
| 3rGew | 140 | 6,58545 |
| 3xG3Q | 136 | 8,71627 |
| 40nhp | 147 | 6,33183 |
| 47R5j | 136 | 5,07535 |
| 48rqO | 140 | 8,84817 |
| 4Bzdt | 136 | 4,71624 |
| 4DmG8 | 156 | 9,27592 |
| 4K8iC | 166 | 9,30061 |
| 4N8OM | 142 | 9,07530 |
| 4N9SQ | 141 | 6,50559 |
| 4Qo2U | 140 | 7,94568 |
| 4Qp5s | 139 | 6,19223 |
| 4RgsN | 186 | 8,78390 |
| 4Rsvl | 139 | 6,15682 |
| 4Uu91 | 137 | 7,84717 |
| 4cn5L | 153 | 6,99201 |
| 4i4Y0 | 151 | 7,02271 |
| 4iA2t | 175 | 7,81507 |
| 4jOej | 140 | 5,66937 |
| 4t4k2 | 137 | 6,15341 |
| 4x9qj | 139 | 6,15682 |
| 4xBeq | 139 | 5,40228 |
| 4xnLI | 140 | 5,45316 |
| 4xswQ | 145 | 8,93591 |
| 5AJpk | 167 | 9,40486 |
| 5AhyU | 136 | 4,82321 |
| 5B2zB | 139 | 7,00293 |
| 5JFQ1 | 136 | 9,29990 |
| 5j2jy | 136 | 5,31185 |
| 5qYMT | 142 | 6,09686 |
| 5yKAu | 139 | 4,97758 |
| 6B2iy | 140 | 7,75013 |
| 6B3FL | 137 | 5,05852 |
| 6B6lr | 136 | 5,08893 |
| 6C9hJ | 137 | 5,45418 |
| 6G3MB | 136 | 4,94496 |
| 6JF9o | 140 | 5,71069 |
| 6JWF7 | 140 | 5,71069 |
| 6Js8G | 140 | 5,67960 |
| 6Pc71 | 196 | 6,89971 |
| 6yAiH | 155 | 9,31834 |
| 77v3 | 216 | 5,56359 |
| 7CiLe | 131 | 5,85143 |
| 7Dr48 | 145 | 5,11462 |
| 7U2bW | 137 | 5,28537 |
| 7XE9Y | 139 | 9,25471 |
| 7XRjh | 143 | 9,17716 |
| 7XyR5 | 137 | 8,96196 |
| 7eaP3 | 139 | 5,62276 |
| 7ef0o | 139 | 5,20125 |
| 7gCf | 205 | 4,96929 |
| 7xbTs | 139 | 6,13392 |
| 7xbW5 | 139 | 5,62276 |
| 86h9 | 142 | 5,82807 |
| 89Qic | 140 | 6,58545 |
| 8AIAe | 137 | 5,25041 |
| 8AMD | 191 | 5,32493 |
| 8By4g | 147 | 5,64317 |
| 8ChhO | 142 | 5,56945 |
| 8DaIW | 140 | 7,95638 |
| 8Fo6O | 136 | 5,09962 |
| 8FtTU | 147 | 5,65886 |
| 8GC2P | 139 | 5,25001 |
| 8aFKc | 167 | 9,35373 |
| 8cgWx | 145 | 5,26638 |
| 8fPlW | 146 | 9,22512 |
| 8gGG | 144 | 9,06653 |
| 8h2wE | 137 | 5,12070 |
| 8hoH0 | 147 | 5,48641 |
| 8n3vu | 147 | 7,73319 |
| 8qSbj | 166 | 9,06943 |
| 8srwH | 148 | 6,83264 |
| 8wjrH | 142 | 5,80482 |
| 8wsqm | 139 | 4,57136 |
| 8xHnZ | 142 | 5,56945 |
| 8xarh | 139 | 4,68236 |
| 8yGlA | 139 | 4,84333 |
| 8zFlE | 139 | 5,16140 |
| 8ztGQ | 139 | 5,06722 |
| 9xX3 | 143 | 8,40366 |
| A6rE | 141 | 8,60223 |
| YYsb | 142 | 7,70466 |
| cfMC | 140 | 5,71069 |
| e2Yn | 137 | 4,94712 |
| i6kx | 114 | 9,77200 |
| seBQ | 137 | 5,13281 |
| tOla | 143 | 4,90693 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_32797
2yPO8
|
5731 | 48,1% | 137 | 1.577E-65 |
| 2 |
phalp2_17008
8jNgs
|
3526 | 41,7% | 139 | 4.156E-62 |
| 3 |
phalp2_6283
6Psj3
|
6 | 47,3% | 131 | 6.559E-57 |
| 4 |
phalp2_16834
1uDRT
|
24 | 44,1% | 136 | 3.167E-56 |
| 5 |
phalp2_27968
RI1z
|
5083 | 39,5% | 134 | 2.356E-53 |
| 6 |
phalp2_24213
2KXlJ
|
83 | 41,8% | 148 | 2.134E-52 |
| 7 |
phalp2_8442
12q1i
|
28 | 45,2% | 137 | 1.030E-51 |
| 8 |
phalp2_6928
2KMCh
|
358 | 38,3% | 159 | 3.627E-51 |
| 9 |
phalp2_14448
4FjnP
|
18 | 35,9% | 142 | 3.727E-45 |
| 10 |
phalp2_10326
1pOZW
|
1 | 48,6% | 146 | 2.221E-43 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(80F6A)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50