Protein

Protein accession
3MqZ1 [EnVhog]
Representative
5d7gp
Source
EnVhog (cluster: phalp2_14585)
Protein name
3MqZ1
Lysin probability
94%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MITLTQYVGPHINSPDWTLERQANAASLLVSCSRLETLAKADGIKFPDNPATGNGISGATFGGFRPQNCPQGAPQSSHKEGLAVDRYDPDGEIDKWCLLNLDRLVSCGIYIEHPDSTLHWSHWTTKSPKSGRRVFYP
Physico‐chemical
properties
protein length:137 AA
molecular weight:15095,8 Da
isoelectric point:6,49
hydropathy:-0,50
Representative Protein Details
Accession
5d7gp
Protein name
5d7gp
Sequence length
165 AA
Molecular weight
17630,97820 Da
Isoelectric point
7,04260
Sequence
MTITPEQMTARASLTLAQYAGPYLGHADFTAERRVRAIHLLACMHDVLMSATINAVELEINPHTGSLIAGSGNGGFRPQACAVGAATSAHKEGCGIDIRDTPSRAFARWCLQNEARLKAAGICAIEDPRWTPTWVHLQTRPVPSGHFAFIPSASPPLAPPLPEQA
Other Proteins in cluster: phalp2_14585
Total (incl. this protein): 243 Avg length: 142,9 Avg pI: 6,75

Protein ID Length (AA) pI
5d7gp 165 7,04260
12ZTG 137 6,15586
14D6N 140 6,63683
18sWs 135 4,88704
19DWZ 135 8,86680
19EzL 137 6,96445
19FGE 155 6,04002
19Ty9 136 7,85955
1DNuq 156 5,46174
1DPke 165 6,75090
1GBVJ 154 5,43741
1HZRN 155 6,19655
1I0Xb 155 6,00802
1IEGz 147 9,24968
1J67d 131 6,95564
1K1gO 137 7,12826
1KCO7 137 6,49223
1KMhH 137 6,88806
1KOTK 137 6,99923
1KR6z 137 6,49604
1KU5I 150 6,89760
1KdYT 128 4,92097
1Kmje 133 7,76866
1Kts6 137 6,16353
1KuCR 137 8,68017
1KuIE 137 6,49308
1L5GD 137 7,10439
1LF8R 128 5,06983
1LIy7 136 6,89709
1LwaH 135 6,29875
1Ly0l 133 6,36906
1M0mG 135 6,03706
1M517 138 7,15338
1M6Pt 155 5,76327
1MIFQ 135 7,71194
1MM62 137 5,56519
1MgGe 136 8,73355
1Mh3B 141 5,20483
1Mqh6 119 7,89346
1MtIq 138 6,63359
1NHvL 157 5,40172
1NafK 166 5,55689
1Q404 155 5,14287
1Q5oc 166 5,60776
1QScJ 155 5,41831
1QuyU 135 5,80908
1XHgu 137 5,74605
1Xz0w 137 7,04306
1YeEH 166 5,61344
1b3BS 141 7,74877
1bgUT 168 7,88379
1dDAx 137 6,49547
1dkkD 132 5,34465
1eBPw 125 9,44160
1fCQZ 132 6,89073
1gnhz 136 7,70125
1goZr 161 6,41140
1imNZ 136 6,89914
1j4Db 140 8,86777
1kKNh 138 7,74496
1kplz 181 6,34757
1nBwe 136 7,75457
1nkfi 128 5,33504
1oU3c 143 6,95825
1olsW 148 5,81226
1onCF 176 5,67068
1smsx 137 5,91975
1ymGa 136 8,84901
24OnS 136 4,82543
24WB4 159 7,73200
27ObL 134 8,99071
2836T 134 8,71163
2CMK1 146 8,73226
2CNa7 151 5,44537
2DdTN 141 6,40214
2Oy8I 166 8,66760
2WQhg 144 8,01950
2WQkD 162 8,12516
2ZwGY 143 8,05586
2ab7s 156 7,71791
2adfd 143 5,92486
2jsza 135 6,81445
2tDxI 165 8,27273
2tiBq 156 7,72814
361AI 137 4,74437
37VFn 136 5,67466
3JVmv 142 6,70486
3QAkb 143 5,72769
3RagH 138 5,93055
3T69f 140 5,88388
3UH27 123 9,33375
3XdaA 137 6,17751
3YP6n 143 5,19323
3YPKU 137 5,81766
3g6sN 135 5,35852
3hbgH 159 6,57862
40VMS 159 7,78541
44Ez5 155 6,74812
456fZ 172 6,90505
4A356 136 6,50195
4B7Lw 138 9,09689
4DnGP 131 5,18095
4GBi9 134 6,95899
4Gi7u 136 8,62743
4GldF 143 9,60626
4GsiH 138 5,25007
4GyBp 136 8,60938
4H10l 137 6,21224
4IDRe 137 4,71828
4IhUn 166 4,79604
4Kc4h 158 7,70784
4LLPZ 160 5,57900
4NrOA 135 8,51739
4QkAi 160 6,57419
4QylY 143 5,81812
4UOsx 164 5,50022
4V54H 144 8,01950
4cQOP 137 5,56348
4cT3l 137 6,88976
4e10o 154 6,02086
4ePGo 135 6,20428
4eWPK 159 6,06668
4elpT 136 6,20684
4epG5 134 6,27022
4f01D 161 6,95655
4fMAI 153 6,28363
4fgti 137 6,39327
4gCh9 135 6,27090
4gLxv 156 8,61054
4gObE 132 6,20855
4gUF3 157 5,31708
4jMAX 141 8,58340
4jU0Z 137 5,42781
4jV4A 159 6,93705
4kJhW 137 6,05468
4kL5c 147 6,50053
4okgn 137 6,03269
4on2L 144 9,20520
4osnZ 135 5,70791
4p7Mn 136 8,64561
4pIR6 136 8,51732
4r3jh 137 5,62475
4vgWY 137 5,17163
4w1ES 135 5,26303
4w33S 147 5,23154
4zQ90 135 8,58192
50crS 135 4,93615
50fSf 139 7,90642
538kN 157 6,29199
56CRl 136 8,84869
59YAJ 135 5,34277
59ZBC 136 8,53228
5AxcG 157 5,79283
5BnmP 142 6,42442
5Daey 136 8,66586
5E2Jp 132 5,29338
5EggT 135 8,86629
5F5SF 137 5,19568
5Hpui 154 6,58198
5IR4X 132 6,48842
5IRPH 136 4,68032
5ITh0 151 7,05675
5Idoe 162 8,89640
5InZN 151 6,82531
5IxuE 159 8,71272
5Iy80 151 5,25428
5JB3F 104 8,61789
5JEJO 141 8,53834
5a2JQ 136 6,35428
5b5QY 136 6,82087
5eWbe 136 7,87676
5fSiy 136 8,74502
5iaVb 136 8,53247
5jcmB 137 5,21392
5k274 160 5,51863
5kLEt 136 7,85968
5qT6M 139 8,89820
5t1Lf 136 5,92043
5uXsJ 132 6,19655
5vPuC 136 8,50436
5w4cr 159 6,41754
5wSjG 136 8,62763
5yTCs 157 5,28218
6AQDa 136 6,39856
6ApMN 135 9,07568
6AyAy 136 6,12710
6DLFz 145 5,18942
6DcKm 145 5,04227
6FFPt 170 6,03314
6I00I 135 5,03624
6IMNU 170 5,92822
6M2O9 135 6,74050
6NbH5 160 5,24655
6O91c 151 4,87721
6PjT2 157 5,90514
6QurP 134 6,64280
6R9gj 152 7,00162
6U65M 125 7,79618
6UjQu 137 5,50352
6VBst 171 8,20181
6xFi1 137 6,02257
6z4fs 158 6,07100
7Fza5 135 9,33381
7HPWf 158 6,28062
7Vt4y 131 5,67937
7Vv6I 137 6,27226
7W5H5 137 8,90716
7XIbX 128 5,06568
7YRwF 145 5,45975
7YVOk 140 5,44531
7Yh5P 135 5,25922
7cbN 134 8,53615
7jUTR 158 5,89281
7jVRC 161 6,05934
7o0pn 137 7,80153
7on4p 137 6,73948
83GOx 138 5,51017
84FEf 136 7,88759
84HUv 123 8,92882
8849Q 123 7,01481
88HDI 136 7,85169
8aOdA 134 6,57317
8alFR 135 4,88016
8as93 135 5,91310
8eIHe 147 9,20249
8ea1O 150 5,64891
8flS3 137 6,49473
8iO5p 158 5,23137
8iTHX 158 6,90363
8jwrf 139 5,92049
8m3uu 136 7,85968
8mrQn 120 5,22375
8oYXS 138 9,40582
8rDkp 153 8,39064
976K 149 9,47287
CajG 136 8,60938
Itz3 163 5,56325
J5PZ 137 7,77909
QG63 136 5,92674
SpX9 135 5,14964
dzsU 137 7,00259
gABN 137 5,17544
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_15517
8mC4m
491 30,9% 152 5.309E-38
2 phalp2_20385
33bGm
46 29,8% 151 1.237E-36
3 phalp2_5029
1lonk
28 30,1% 169 9.369E-25
4 phalp2_37792
4Bm8N
62 28,6% 150 1.282E-24
5 phalp2_35976
5mq0M
5 28,0% 146 2.401E-24

Domains

Domains
Unannotated
Representative sequence (used for alignment): 5d7gp (165 AA)
Member sequence: 3MqZ1 (137 AA)
1 165 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (5d7gp) rather than this protein.
PDB ID
5d7gp
Method AlphaFoldv2
Resolution 94.88
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50