Protein
- Protein accession
- 3IezB [EnVhog]
- Representative
- 8lAFw
- Source
- EnVhog (cluster: phalp2_3183)
- Protein name
- 3IezB
- Lysin probability
- 94%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MNREVLIVFAILALCLIYALAAVPTRADAAATAYRVDADPPAAEPITTCEEKTKVCYELSEEERAIVESVVMAEAGAEPYIGKMAVAQCILDACKSEHERPTEIVKSFGYTDKRPEPNEDVKRAVSAVFDSGEVATDAEILYFYAPALVSSEWHESQTYVCTIGGHRFFEEVRK
- Physico‐chemical
properties -
protein length: 174 AA molecular weight: 19187,6 Da isoelectric point: 4,65 hydropathy: -0,04
Representative Protein Details
- Accession
- 8lAFw
- Protein name
- 8lAFw
- Sequence length
- 147 AA
- Molecular weight
- 17077,95590 Da
- Isoelectric point
- 4,79456
- Sequence
-
MVEYSHPPFFNLTETDRKTIQYIVAGEAKGEPMEGKMAVAQCILHGMVKSGWSAERVRIEYQYSGWDDELKNANPEVWAEVVEAVSRVFDDGELISDKPILYFYAPKRVSSSWHESLNFSCELSNHRFFYLDEDVNADWFLNLRKDV
Other Proteins in cluster: phalp2_3183
| Total (incl. this protein): 153 | Avg length: 172,4 | Avg pI: 4,62 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 8lAFw | 147 | 4,79456 |
| 1gAtk | 181 | 4,40362 |
| 1gINK | 103 | 6,72413 |
| 1gzXX | 201 | 4,85322 |
| 1jHRt | 182 | 4,58613 |
| 1kc1I | 178 | 4,26761 |
| 1kdWQ | 158 | 4,64559 |
| 1keeQ | 130 | 4,83338 |
| 1nfkU | 158 | 4,79286 |
| 1obGb | 257 | 6,40566 |
| 2lUGq | 158 | 4,64195 |
| 2lVoV | 179 | 4,33797 |
| 2m2VN | 183 | 4,23385 |
| 3B5OE | 178 | 4,57778 |
| 3caAR | 201 | 5,00669 |
| 3l2ot | 179 | 4,33797 |
| 3l5OA | 162 | 4,67674 |
| 3lTJi | 166 | 4,51639 |
| 3lisg | 166 | 4,46706 |
| 3msUo | 178 | 4,25976 |
| 3msat | 162 | 4,71414 |
| 3nFiK | 184 | 5,20915 |
| 3nxzz | 160 | 4,50207 |
| 3p9hc | 160 | 4,59790 |
| 3pDvw | 164 | 4,62837 |
| 3pSvV | 179 | 4,41022 |
| 3qoyb | 174 | 4,66457 |
| 3rVyi | 158 | 4,64559 |
| 3rvzi | 179 | 4,32473 |
| 3s8KO | 158 | 4,64559 |
| 3sVOn | 176 | 4,12454 |
| 3sgSh | 178 | 4,56277 |
| 3sjIy | 178 | 4,42312 |
| 3skvb | 168 | 4,63024 |
| 3t3Dh | 179 | 4,45273 |
| 3tWNJ | 161 | 4,43369 |
| 3tWk6 | 178 | 4,56277 |
| 3tcjW | 174 | 4,57187 |
| 3uEp3 | 173 | 4,75614 |
| 3ueqO | 174 | 4,67708 |
| 3v168 | 168 | 4,44847 |
| 3vCq4 | 162 | 4,89483 |
| 3vKUE | 162 | 4,43807 |
| 3vLUo | 134 | 4,64587 |
| 3vy8F | 178 | 4,61632 |
| 3vymn | 173 | 4,56277 |
| 3wcjJ | 164 | 4,43369 |
| 3wjJV | 178 | 4,49820 |
| 3xXo9 | 166 | 4,59790 |
| 3xZCg | 162 | 4,59216 |
| 3xpmy | 178 | 4,39169 |
| 3y2fN | 162 | 4,50207 |
| 3y5Kg | 179 | 4,48479 |
| 3y9cY | 178 | 4,48240 |
| 3yAQJ | 170 | 5,46492 |
| 3yHjM | 158 | 4,50656 |
| 3yPK9 | 177 | 4,62109 |
| 3yj89 | 170 | 4,55277 |
| 3ylxK | 162 | 4,45665 |
| 3zIyH | 211 | 4,42482 |
| 3zxTB | 134 | 4,66139 |
| 4yntq | 112 | 4,45808 |
| 4z47s | 172 | 4,54049 |
| 5MQSq | 174 | 4,55982 |
| 5Mthh | 211 | 4,52713 |
| 5OW2Y | 160 | 4,59790 |
| 5P5wn | 186 | 4,59307 |
| 5Pqlu | 211 | 4,50360 |
| 5QPkK | 158 | 4,66093 |
| 5Qsh4 | 187 | 4,81633 |
| 5R68Q | 164 | 4,42596 |
| 5RdVo | 166 | 4,56465 |
| 5S3ij | 175 | 4,74653 |
| 5SR2p | 168 | 4,64303 |
| 5SeFh | 174 | 4,56209 |
| 5SjKB | 174 | 4,60188 |
| 5Sn3G | 164 | 4,46279 |
| 5TBbu | 162 | 4,76938 |
| 5TShx | 187 | 4,46779 |
| 5TxjM | 174 | 4,31876 |
| 5U4jn | 211 | 4,60796 |
| 5UHZ0 | 162 | 4,63604 |
| 5VBd5 | 158 | 4,46848 |
| 5W4km | 179 | 4,41022 |
| 5WwSk | 156 | 4,57840 |
| 5X2Ge | 174 | 4,47115 |
| 5YmSe | 178 | 4,61632 |
| 5Z3PS | 174 | 4,56209 |
| 60DZI | 178 | 4,34457 |
| 62PDq | 158 | 4,58272 |
| 62qxv | 174 | 4,49400 |
| 63VIQ | 186 | 4,70822 |
| 63VMA | 164 | 4,52208 |
| 64hGZ | 103 | 5,70939 |
| 660nG | 174 | 4,56488 |
| 66MiP | 211 | 4,59648 |
| 67yQf | 211 | 4,65002 |
| 69W2D | 178 | 4,25022 |
| 69uIE | 172 | 4,52804 |
| 6YyAx | 178 | 4,22401 |
| 6ZmTI | 168 | 4,51611 |
| 6aUE0 | 168 | 4,46677 |
| 6b1GP | 186 | 4,60489 |
| 6b5VL | 159 | 4,61279 |
| 6cZ5y | 162 | 4,47103 |
| 6chtI | 166 | 4,50838 |
| 6dsNc | 211 | 4,49121 |
| 6edTK | 164 | 4,59790 |
| 6ejpn | 211 | 4,52713 |
| 6erj2 | 168 | 4,70589 |
| 6f6Fh | 169 | 4,80064 |
| 6fJCd | 159 | 4,42841 |
| 6fgOB | 164 | 4,41044 |
| 6fz9v | 168 | 4,58596 |
| 6h6lg | 172 | 4,52804 |
| 6hJqn | 159 | 4,44836 |
| 6haLd | 170 | 4,59983 |
| 6iKbf | 156 | 4,76580 |
| 6kOMC | 179 | 4,48479 |
| 6kU5W | 182 | 4,53072 |
| 6lGt1 | 174 | 4,60188 |
| 6mRps | 172 | 4,61251 |
| 6n9IJ | 180 | 4,53015 |
| 6oNx3 | 187 | 4,72511 |
| 6oZA1 | 158 | 4,62996 |
| 6opLC | 168 | 4,59972 |
| 6pfU1 | 159 | 4,56692 |
| 6qTCm | 162 | 4,82219 |
| 6rGsv | 167 | 4,46552 |
| 6rwet | 164 | 4,62996 |
| 6umx2 | 208 | 6,33797 |
| 6vPBY | 160 | 4,59790 |
| 6vSuZ | 211 | 4,55669 |
| 6w0eR | 177 | 4,81332 |
| 6w3Uj | 133 | 4,66008 |
| 6wbyU | 174 | 4,55061 |
| 6wnpg | 174 | 4,64331 |
| 6woD1 | 178 | 4,42312 |
| 7WPt6 | 174 | 4,60188 |
| 83KHK | 170 | 4,63024 |
| 83Ltk | 178 | 4,32592 |
| 87IA5 | 165 | 4,48098 |
| 89WRW | 195 | 4,79110 |
| 8bLlT | 205 | 4,46240 |
| 8bZcb | 195 | 5,48220 |
| 8fNKJ | 178 | 4,56277 |
| 8lg0G | 178 | 4,51753 |
| CS9b | 179 | 4,32473 |
| F3an | 164 | 4,66093 |
| F5Bv | 162 | 4,43807 |
| HqN6 | 182 | 4,55493 |
| HqgT | 179 | 4,23385 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_24037
80uQf
|
46 | 67,7% | 127 | 1.130E-60 |
| 2 |
phalp2_17998
1gOqM
|
126 | 46,0% | 126 | 7.640E-50 |
| 3 |
phalp2_20006
1jC1n
|
4 | 40,3% | 124 | 9.542E-49 |
| 4 |
phalp2_20812
64SMJ
|
1 | 33,6% | 119 | 1.495E-23 |
| 5 |
phalp2_8009
5otka
|
1 | 38,5% | 109 | 1.351E-22 |
| 6 |
phalp2_6212
6bb7E
|
1 | 25,0% | 116 | 5.805E-15 |
| 7 |
phalp2_19123
1FKpE
|
5 | 30,2% | 119 | 7.938E-15 |
| 8 |
phalp2_5713
4Io2I
|
2 | 24,6% | 134 | 6.315E-13 |
| 9 |
phalp2_34576
4ZO4j
|
9 | 32,5% | 120 | 3.007E-12 |
| 10 |
phalp2_13823
7csSp
|
6 | 27,6% | 112 | 1.047E-11 |
Domains
Domains
1
147 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(8lAFw)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50