Protein

Protein accession
3IQZg [EnVhog]
Representative
8Giu0
Source
EnVhog (cluster: phalp2_27881)
Protein name
3IQZg
Lysin probability
98%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
PCKAEKLPEELREPYFLFVVNAGQGKAVKVLQKACNAKNKKSEQITVDGRIGRMTIGASKKLKKDRFVSYIVLEYARIVYRNVSQERFWYGWYKRALGL
Physico‐chemical
properties
protein length:99 AA
molecular weight:11487,3 Da
isoelectric point:9,97
hydropathy:-0,45
Representative Protein Details
Accession
8Giu0
Protein name
8Giu0
Sequence length
98 AA
Molecular weight
11344,24190 Da
Isoelectric point
10,43551
Sequence
mpskasqvpaqlreiyfdmvvnfgrrgavkvlqkacngknifeidvdgrigpatlgacrnleperlrayrilkfanivikkrsqekywfgwfrralkv
Other Proteins in cluster: phalp2_27881
Total (incl. this protein): 207 Avg length: 152,2 Avg pI: 8,21

Protein ID Length (AA) pI
8Giu0 98 10,43551
10fpC 171 8,65844
10lUY 160 6,90164
1A9Pw 183 8,82870
1RYep 192 8,71266
1SygZ 160 6,20940
1UEvI 66 9,94149
1Uu0t 160 8,39722
1V3e3 177 8,98156
1VB6c 160 7,69722
1Vco8 160 8,33662
1W0Kk 168 7,75150
1WsOM 164 6,51957
1gePz 163 9,29887
1uw7J 183 8,96596
1x4es 160 6,95842
1ypIs 113 9,73236
22mKm 160 6,95831
25xA 149 9,20849
2ALht 160 7,73092
2GJDK 160 7,72961
2Gjsd 160 5,86609
2K7Fe 160 6,30193
2MYk7 160 5,86171
2Nduz 149 9,20849
2TYOK 165 7,71859
2bhx 149 9,20849
2od9 164 7,81771
2pU1K 160 6,51349
2q49L 160 6,29943
2uqP0 85 10,29297
2v4So 160 8,32276
2wvV7 159 9,14653
2xPdt 183 8,64974
2y3jb 160 6,90096
2y72T 160 6,20138
2zE7q 182 8,62647
32nAN 160 6,10021
36eSC 183 7,71620
3BEcX 140 9,63553
3BGVJ 118 9,76356
3BY1r 183 8,67140
3BuAK 109 9,96348
3Bwdh 160 8,70525
3C5xF 183 8,34732
3CquE 80 10,70493
3D2wk 160 6,97104
3DYMs 166 9,28030
3DzZV 160 8,53047
3EAPB 160 6,95757
3EU6y 159 9,42994
3F7Ve 130 9,51806
3FBVM 140 8,76449
3Fokl 123 9,20243
3GSmU 160 7,72274
3HQqv 81 10,54750
3HUtJ 160 6,21503
3HZYx 160 7,72251
3HshX 160 6,20673
3J1Eh 127 9,31802
3JgIC 110 9,86490
3KddB 160 7,01219
3KmzT 160 7,70046
3KpnE 186 8,39715
3Kpxh 80 10,20298
3M4hw 160 7,69261
3QRXl 160 6,52127
3TcBR 165 8,71750
3YgEr 183 8,66121
3cBnT 183 8,67069
3csjB 160 8,64845
3oAsj 99 10,71002
3oB34 165 8,36582
3oBEu 199 9,35689
3oFjP 92 10,42236
3oLnl 168 7,75150
3oNw5 89 9,69516
3rBaj 104 10,08442
3rHUl 160 6,95859
4P8pU 160 6,43141
4RZyD 77 10,42623
4SygU 157 9,40318
4SzRK 111 9,56629
4t4Jp 177 7,11854
5AoJS 160 6,42902
5pR1b 164 9,26045
5qXhZ 160 8,34532
5r42Q 177 8,57895
5s2hC 160 8,34545
5sBGY 175 9,21764
5sEdn 177 8,57895
5szAg 157 9,49988
5zYHK 177 8,80859
6VUyp 158 8,75147
6VVwX 160 9,05280
7CIfs 160 6,96132
7CfqV 58 7,87193
7F1lr 165 8,71685
7F3rX 149 9,20849
7F90q 149 9,20849
7FqZ5 165 8,39560
7GU3B 73 10,71408
7Gxxp 160 6,09760
7LeUR 149 9,20849
7SSI3 135 8,91638
7T9oU 160 8,72936
7TPNW 69 10,26132
7TwkX 96 9,93002
7UyFE 159 9,29887
7VYjg 183 8,69396
7VijA 160 8,34016
7Wcbr 183 8,35821
7Wo7C 170 6,96507
7WohK 160 6,96030
7WwYV 164 6,51957
7WzsJ 160 6,10027
7Zsnz 160 7,76139
80SD0 183 6,90266
80T89 160 5,97164
80uqe 160 6,21611
81d46 165 6,90374
81zxZ 160 6,90278
82QGX 160 6,95859
83Q47 160 7,71432
845xo 160 5,17163
84adY 160 6,51741
84kqF 160 8,65786
84sj6 160 7,69653
86VOK 80 9,56023
89ZD7 160 7,70137
8A83z 160 9,02056
8AgGP 160 5,95646
8B2Vl 165 8,39548
8B4fu 160 9,00696
8BQkB 160 6,10021
8BVYC 160 6,10021
8BpcE 160 8,32276
8BrUQ 160 8,85894
8CdNE 160 7,69653
8D3C6 137 9,08232
8DE5v 160 6,52235
8E9kb 104 10,52648
8EE1B 160 6,95859
8EhSU 127 9,39403
8Erip 183 8,64974
8EuaO 162 9,42536
8FQad 160 8,33442
8FunS 160 7,72637
8G7aJ 129 9,67098
8GnWb 160 8,70525
8GxZP 160 8,32276
8Gytp 160 7,70029
8GzRE 164 8,79699
8a0Nw 160 6,09635
8aa2W 165 8,37543
8abW1 183 7,71671
8bUgz 160 7,72251
8cLEH 165 7,73575
8cfw6 159 8,79705
8fIDf 160 6,29943
8fTAo 160 8,64716
8gXpg 160 6,59141
8h7u1 160 7,69233
8hGFy 183 8,66012
8hRNT 161 9,29868
8hvIR 160 6,59477
8kkeE 212 8,88550
8oY8p 165 6,96144
8sNfX 160 7,69636
8u7Nf 160 6,37548
8u8vC 165 6,90545
8uGfN 160 6,20946
8uQBh 159 8,79705
8uYRc 160 7,69653
8uqzi 165 6,96252
8ur6p 160 7,69625
8vW2q 160 8,34016
8vvRs 160 8,36421
8vxEz 183 8,82896
8w9Be 160 5,83506
8wKL4 160 8,39722
8x4Uy 160 7,69653
8xFeL 160 6,42902
8xhhW 160 6,96030
8yETx 160 6,42931
8yl8U 160 8,33829
8z5Y8 160 6,37548
8zAMD 116 9,46584
8zWGp 160 8,84708
8zWUL 160 8,84708
8zoPr 160 5,27235
8zwLS 188 9,36012
CAPV 164 8,42004
NVCT 178 8,97369
QXtK 94 9,82558
Rhb1 94 9,82558
V3hC 178 9,15259
VE77 106 9,81191
XiRJ 178 8,61892
c251 149 9,20849
czkZ 98 10,04883
ddn4 160 6,89954
piBb 75 10,71492
rFiY 111 9,95522
w5NP 160 7,70506
zvAF 80 10,97486
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_30682
6VXDs
19 53,7% 67 1.538E-29
2 phalp2_22755
8lP1D
1 52,3% 63 8.220E-19
3 phalp2_13258
3amCV
437 35,9% 103 2.462E-16
4 phalp2_28839
4XJZ6
27 38,0% 100 2.462E-16
5 phalp2_4684
4Ht8d
20 38,0% 84 6.768E-13
6 phalp2_24538
7FyoR
12 34,3% 96 6.213E-12
7 phalp2_37756
4ljFe
3 29,1% 96 7.826E-11
8 phalp2_4691
4JcKB
22 36,4% 85 2.777E-10
9 phalp2_16811
1lgju
1 27,1% 107 2.777E-10
10 phalp2_22059
5CcNX
221 30,2% 96 1.352E-09

Domains

Domains
Representative sequence (used for alignment): 8Giu0 (98 AA)
Member sequence: 3IQZg (99 AA)
1 98 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF09374

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (8Giu0) rather than this protein.
PDB ID
8Giu0
Method AlphaFoldv2
Resolution 94.38
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50