Protein

Protein accession
3IFJD [EnVhog]
Representative
3ISMN
Source
EnVhog (cluster: phalp2_10773)
Protein name
3IFJD
Lysin probability
98%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MKDLLEKIKEHEGFREKTYKCTEGYDTTAYGFAWKDLYLSEDMANELLQRNKNNIVFYEDIAEDVLIEKLEKLKRNAISRFKWLEDMPQEVQEVILNMCYQLGVAGVSKFRKAISALQEGEWN
Physico‐chemical
properties
protein length:123 AA
molecular weight:14536,4 Da
isoelectric point:5,02
hydropathy:-0,59
Representative Protein Details
Accession
3ISMN
Protein name
3ISMN
Sequence length
102 AA
Molecular weight
11544,43890 Da
Isoelectric point
5,53512
Sequence
MKDLLESIKHHEGFVEHVYDDSLGIPTIGYGFAIKDLVLQEDLCDEILLRKLRILGRSVMSKFPFFDSLPSDCKTVLMEMCYQLGVTGVSKFKKALKAMEDG
Other Proteins in cluster: phalp2_10773
Total (incl. this protein): 265 Avg length: 137,1 Avg pI: 6,37

Protein ID Length (AA) pI
3ISMN 102 5,53512
11D1g 138 5,29821
11QO0 150 8,36111
11Vg5 135 4,87061
12huy 134 7,86451
12lkc 141 4,89079
12rNQ 149 4,71243
12wpW 134 4,49485
1E5xZ 185 6,64524
1SZdG 134 9,01792
1SdrA 134 7,68284
1TOyi 140 5,26087
1Tqxh 139 9,07903
1ZpQ5 141 5,46327
1fIVm 71 4,33036
1g2Yw 136 5,77316
1g4XC 140 5,52040
1gHQw 139 5,61753
1ga10 140 9,09837
1nXg 138 6,14477
1wa6j 134 7,64532
1wbGp 135 4,60120
1x1Q0 135 5,14901
1x4zK 136 5,09479
1xedv 135 8,34023
2AFBN 147 5,26598
2AIkF 134 6,89726
2AORs 135 6,96081
2AsZT 147 8,58379
2C17Z 134 8,47600
2CIIn 134 5,50783
2CqZy 136 5,73258
2UUBO 85 6,19371
2UURJ 137 7,82242
2V4A0 137 6,43636
2vDWj 147 5,12167
2w0bq 142 6,14221
2xSgT 140 8,26364
2xYpa 142 5,96982
2yDzY 147 6,36457
2zFdK 141 4,89079
3AJuu 135 8,37768
3AOaX 139 5,20647
3AROb 135 5,93492
3BQhG 142 6,83503
3CEKD 135 6,60716
3CEei 134 4,72817
3CFCN 133 5,48760
3CIT6 135 7,65203
3CIy1 134 6,42021
3CJq1 134 6,90551
3CLEk 140 7,60741
3CLME 135 8,81929
3CQwQ 136 4,76637
3CioV 139 5,73241
3Dkmd 81 4,75063
3DtGN 147 5,21023
3E29L 134 8,84372
3E4g0 136 6,61034
3E68M 140 4,94473
3EDtJ 92 7,69994
3EJsp 146 5,94169
3EKir 136 5,27002
3EOp3 135 6,28994
3EQ3m 137 7,73018
3EUnp 139 9,42252
3Ez44 134 5,27462
3GVLP 133 5,31561
3GWQY 146 5,65618
3Ggpx 85 4,14415
3GvlI 139 5,73241
3H42G 136 5,14452
3H54z 134 8,70357
3H7ME 134 6,90420
3H7Qu 144 5,79322
3H7YO 147 6,52412
3H85Y 134 5,91224
3H872 140 4,99361
3H8NQ 136 8,74167
3H8UG 132 8,29020
3H8bY 135 8,34770
3H8g4 136 4,78257
3H8uP 141 5,13145
3HaTS 141 5,13685
3HbAD 134 4,94496
3HbeF 136 8,89852
3HcMO 146 6,82968
3Hd4u 134 8,37942
3HeUX 134 6,19576
3HeZB 135 5,36869
3Hg4P 147 5,30418
3HgXa 136 5,92827
3Hh48 136 5,03130
3Hh7t 133 7,68005
3HiJg 141 5,24996
3Hinf 134 6,84128
3HjOE 135 8,48547
3Hk7f 135 7,74394
3HkJz 140 5,45946
3Hl6H 136 5,31282
3Hln3 134 6,75045
3HluK 136 5,00623
3HqcF 137 5,94811
3IDYp 140 4,84765
3ILZS 140 4,88403
3ILwh 135 4,98685
3IRKB 157 7,80417
3IiZn 139 5,07870
3Imx6 140 4,84663
3Ivcf 134 5,53404
3JAW5 133 9,51761
3JYFl 133 9,18431
3JlaK 137 5,80385
3Jxn6 142 6,83167
3K51r 135 5,94118
3KUUx 141 5,13685
3KV7s 145 8,29194
3KWIf 134 4,74471
3KWwy 135 5,30003
3KXQV 136 5,56217
3KYtx 140 7,60332
3KZsE 134 7,74553
3L2nr 136 4,73500
3Lb0s 141 5,04255
3Lddm 136 5,10195
3Lfwp 140 4,93467
3U93N 134 6,18979
3UTga 141 8,51461
3aTuT 141 9,43980
3rBKO 138 9,14724
3rIn8 133 5,29423
3rw1n 136 5,70995
40QxO 134 4,87829
4AOde 142 5,38495
4FIm4 134 8,77803
4NdfY 137 6,73209
4OJ9s 147 6,90965
4PO5s 141 8,51442
4PUkh 147 5,27008
4Pofb 141 8,84856
4RG35 91 6,08191
4S57A 110 5,62225
4ULQa 140 4,84145
4Uxkc 140 5,13867
4UyKV 134 8,39728
4V1rj 146 5,04340
4V3cZ 134 7,64100
4X02 136 4,97253
4ZNEP 134 7,93279
4fQp1 152 8,44370
4wEn3 142 5,95203
5hxMJ 149 9,05589
5qWZJ 137 5,78760
5qX5P 140 5,03056
5qZDP 146 5,94169
5r0Fk 134 8,92612
5r4aA 140 4,93132
5rEG3 110 5,40484
5s1AB 134 6,06884
5sCSE 148 5,20306
5sb4f 138 5,76497
5sepb 147 5,28423
5srMz 140 5,02982
5sx10 133 5,47566
6y9Pu 149 9,05589
7CWDg 146 5,65351
7ChOx 109 6,71765
7DasQ 133 8,42410
7DsZa 133 4,94814
7EdSF 140 4,74096
7SEdI 137 6,84429
7SOiL 134 7,81984
7T0QN 142 6,14608
7T3ma 136 6,73698
7TtZc 151 7,62838
7U9PO 136 9,06504
7vzlB 146 7,76446
83hOh 139 9,26109
848eD 135 6,19439
85r5g 135 5,48760
8AHv6 139 5,31021
8AhVr 136 8,74167
8Apbp 136 5,28008
8Aslk 134 4,74471
8BIsU 134 5,26087
8BJ4E 143 5,74912
8BO2h 135 6,72646
8BTex 147 5,61213
8BaCq 146 8,55639
8CZY2 143 5,63766
8DEwQ 134 4,72817
8DMfc 147 5,26598
8DNWG 143 5,93561
8DOEr 147 6,09765
8DQ8h 139 5,20647
8DSan 143 5,93561
8DVbO 141 5,24996
8Dntp 140 7,69591
8E5J3 166 9,09734
8E91W 136 6,40305
8EZlJ 136 5,06631
8Eo1K 132 5,90434
8FAsc 132 7,71961
8FBov 97 4,35366
8FPdt 134 8,36743
8Fzvd 134 6,42021
8GOkA 133 9,54237
8Gcxf 141 4,84663
8Gmkk 140 4,89039
8c4nh 141 8,85243
8cQ0A 135 6,60159
8fTmk 134 4,97253
8g6mM 142 6,14597
8gMIu 139 5,42178
8hSZE 134 7,65805
8i2Sy 140 8,37762
8itHz 134 6,59897
8kaVG 155 7,73302
8lNqd 139 5,73241
8o1S5 135 5,94118
8ofDo 142 6,73721
8pg4s 139 5,73241
8t5wh 139 5,45981
8tlqQ 133 9,54237
8tv41 142 6,74062
8u4QQ 136 5,77316
8u8Oi 146 5,94169
8uV7o 134 5,31509
8uYt0 135 5,94123
8vBYh 141 6,14295
8vDII 146 5,94169
8wmn9 143 5,43787
8wzmq 143 5,65351
8yARq 147 5,42656
8yGH3 141 5,00140
8yHFi 135 5,94118
8yzto 134 4,74471
8zJfb 146 8,92650
8zWab 140 5,67130
8zexk 141 8,85243
8zgbQ 146 6,42544
8zhql 137 9,13809
EkBa 135 4,79797
HReS 99 7,90674
HT7u 135 5,03869
I5Jg 135 5,93884
I9kf 135 6,07964
PDgu 175 9,33891
QJm9 144 5,35448
RfWN 155 6,59011
Vj4J 134 6,07640
W7ww 138 5,20289
WJHp 146 5,94169
YXX1 134 4,70498
YZtV 134 5,50778
fRaz 142 7,98791
nEq5 136 5,23739
qMZF 158 6,73783
qWY5 136 5,88172
qWid 136 4,66537
r7bU 135 5,77816
sbks 144 6,17291
vAHP 140 4,82815
zBkb 137 5,23921
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_32797
2yPO8
5731 38,6% 101 1.752E-32
2 phalp2_17008
8jNgs
3526 37,1% 105 4.528E-32
3 phalp2_22992
3CfKl
406 52,8% 70 1.606E-31
4 phalp2_17182
3bGOC
87 45,1% 104 2.203E-31
5 phalp2_10898
4A8EL
88 39,7% 98 3.195E-28
6 phalp2_27968
RI1z
5083 37,6% 101 3.380E-25
7 phalp2_6928
2KMCh
358 32,1% 115 2.842E-23
8 phalp2_21661
31ima
875 33,9% 109 1.008E-22
9 phalp2_23318
5odvd
11 33,3% 96 1.899E-22
10 phalp2_8442
12q1i
28 29,2% 113 4.910E-22

Domains

Domains
Unannotated
Representative sequence (used for alignment): 3ISMN (102 AA)
Member sequence: 3IFJD (123 AA)
1 102 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (3ISMN) rather than this protein.
PDB ID
3ISMN
Method AlphaFoldv2
Resolution 96.95
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50