Protein

Protein accession
3HRb [EnVhog]
Representative
4t88M
Source
EnVhog (cluster: phalp2_21852)
Protein name
3HRb
Lysin probability
97%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MKRVGLVVGHRPSAQGAVNRSHGVSEYKFYDLFVEDLHEDLVACGLVESVIIHRDDTRKGYNKLPNRINELDCDFIISFHANAYNGIASGSEVLYCSKKGKALAGGLQSAQTDVLELPDRGLKYRDEEGRGGHLLWNTIAPCVIVEPFFIDNDEDLKRMSSRYVELRRAYTQAIQEFARSEVTM
Physico‐chemical
properties
protein length:184 AA
molecular weight:20724,2 Da
isoelectric point:5,87
hydropathy:-0,35
Representative Protein Details
Accession
4t88M
Protein name
4t88M
Sequence length
183 AA
Molecular weight
20002,62460 Da
Isoelectric point
6,09305
Sequence
MKTVALVVGHSHEVRGAGNKELGIYEYDFNKLLADKIAPTLIDLGYNPVVIYRDTYAGLPAKINRVNPDIAVSLHCNAFNTKASGSEVLYYDGSNKGKLLAAYLQKAIVEVMRENDRGVKPISYGHVGKAGDRGGYLVAKTTMPTVIAEPLFIDNTDSLTKAQELMDELALAYATAIDNYFKE
Other Proteins in cluster: phalp2_21852
Total (incl. this protein): 271 Avg length: 189,7 Avg pI: 7,09

Protein ID Length (AA) pI
4t88M 183 6,09305
13gNj 189 5,15935
179PC 183 6,20769
1BI9E 184 8,14901
1Budh 176 5,64749
1CTOE 184 6,94507
1E6uE 184 6,58863
1EnQ5 183 5,84336
1HXgj 187 6,06253
1a00t 221 9,01934
1biPs 178 6,29852
1clHP 181 7,00799
1cqAh 227 6,25476
1crCM 182 8,30277
1csXX 180 7,68079
1cwJL 181 8,60874
1cwaU 181 8,29484
1hGVE 208 7,74337
1hPNb 188 8,66972
1jTAa 181 8,28137
1kn2b 144 6,83503
1knE5 181 8,59881
1knmo 180 7,68471
1kqRN 182 8,81407
1kqji 180 7,68448
1qN3S 204 7,74036
1qVL5 184 6,41493
1rbeO 178 8,80846
2KxlV 175 6,41840
2QrRL 184 8,65483
2Vfpn 174 6,41402
2VgM6 214 9,11842
2b2OP 210 5,86143
35D3o 151 8,64671
35HDs 178 5,28389
35kij 186 7,61656
37MTr 184 8,16262
38wEM 183 9,01295
3AMJ7 228 6,44596
3Bw6m 224 5,77822
3CAHb 227 5,86291
3CJGh 229 7,60082
3ENKF 239 6,45523
3G623 227 8,41475
3HHQO 224 5,86137
3XGa 184 6,07696
3YZfg 193 6,59443
3bJuu 188 5,88326
3bKQU 183 9,28469
3cbNG 176 8,57244
3hhNq 190 6,41379
3hy73 173 8,22431
3rO7J 175 6,90471
42Y35 175 7,67090
43c5D 186 6,88271
44UFs 192 5,43195
44UUx 196 9,54366
45OzY 178 6,04860
45P9s 181 5,08882
47P3o 179 5,34391
48nAj 186 8,77577
4BBXi 185 5,93259
4BHov 188 9,27644
4Bk6e 178 7,76207
4CEGz 185 5,04642
4JQsK 182 8,27047
4Km5A 180 9,22499
4NGU1 183 7,78941
4NOii 186 6,52332
4SKsX 147 4,75603
4UkGz 184 6,64774
4Uldv 147 4,75603
4Z9I6 183 5,64686
4Z9mH 173 6,51991
4ZoWj 140 4,88187
4ZqRt 185 5,04642
4hWOk 209 9,10688
4hZI1 214 6,37992
4hlTn 182 8,96789
4htED 175 8,48019
4huXC 192 8,78055
4i007 229 5,73815
4isxp 182 8,25236
4kVAl 181 4,95405
4t5IY 208 9,06691
4tCdc 186 5,39961
4uRAv 179 8,59810
4yCPS 177 7,67226
5jyhb 192 6,00256
5ubU8 176 7,68590
6YCZi 182 6,31398
6YsPo 180 8,30277
6Z1Ul 180 8,30283
6ZlYd 182 6,39117
6b6i7 180 6,59414
6ikgj 182 6,59795
6rwvM 182 6,96274
6tbcf 182 7,60070
6vbiv 180 8,60803
707hY 182 8,31096
71B8f 196 9,12603
71IrI 188 5,87263
71rG0 227 6,01887
72Lv3 174 7,68477
78Xnr 182 7,75803
78hLk 175 7,70830
7BVTg 177 6,33155
7Gejh 252 8,82793
7MDRs 227 6,91443
7Mbz2 182 6,52952
7Nc3g 182 6,31722
7Ny2m 228 6,25987
7O2nf 182 6,52730
7TJ40 188 9,01283
7aKHq 182 7,00929
7cCtl 182 7,05255
7cQqC 185 4,87925
7hhMm 183 8,46845
7qCeT 184 6,59607
7tG1A 188 6,07350
7uDjC 199 5,32794
7wU4z 186 8,45395
7xrRI 182 8,58546
818kx 188 7,63151
82xBx 184 6,99207
84VJ6 230 6,97303
84qAD 230 9,04325
85xq8 179 4,83577
8BPwv 224 8,19027
8Bti7 223 6,78995
8Byoh 209 7,66448
8CaoA 227 8,41475
8D5Ku 239 6,14472
8D7LH 224 5,86137
8DX65 187 6,09555
8E0Db 224 5,86137
8Fl1I 184 8,49727
8Gqkm 239 6,45523
8IFbB 183 9,76208
8IFbD 183 7,75354
8IFbt 178 8,67991
8ajlp 232 7,68903
8gNpQ 228 6,12454
8l7QV 186 6,42635
8phx8 239 5,37460
8wjEo 239 5,37460
8yQP7 227 5,65510
8yymC 231 6,11010
BDNK 180 7,68079
BDmL 182 7,75604
BWmy 182 6,44136
BurS 182 8,54975
C7tj 182 6,96257
CHZx 181 6,22810
CmDp 181 6,96291
CoGI 180 8,26454
DUlT 182 6,31194
Dham 171 9,22551
EImt 181 7,00799
EIzD 227 7,05175
ELc5 181 6,22457
HFQj 182 6,31728
HMxa 182 7,66470
HNa1 181 6,96394
HlHt 184 6,90244
HsES 181 8,60809
Ihk4 182 7,17532
JROe 181 6,96092
JRqL 182 7,70932
JWrh 182 8,30277
K0dB 181 8,60816
K0mE 140 7,76144
KJBc 180 8,29478
KJnS 182 6,96325
KJyH 227 6,61102
KLhC 198 8,28691
KLoA 180 6,59426
MVBc 180 8,27105
MVQm 182 6,30926
MYHx 228 6,54856
MZna 182 6,08373
Mn0s 180 6,22014
N0xu 180 8,29478
NMBW 180 8,29478
Nb4h 182 6,22560
NbFg 226 7,01066
NbPD 181 7,00799
Nc6Y 226 6,33393
Nc9b 182 6,22116
O14J 182 6,31728
O1Km 181 6,52753
O2ON 182 6,53099
O77J 183 7,69000
OOae 182 6,96360
OP7Q 226 6,33393
OaHA 227 6,54685
Oitx 180 8,31289
Ojy3 180 7,67761
OkBE 208 6,33376
Pdzb 179 5,06284
UZQ3 182 7,70137
UwYV 184 6,99207
V08t 182 6,08270
V0dB 226 6,95996
V0eA 181 8,29471
VOV3 227 6,54412
XXRd 179 7,60661
aRVT 187 6,57789
aa3W 185 5,25979
d50Q 179 6,95831
dnLz 188 6,99440
eVD6 177 4,61768
f733 177 5,54950
gFVw 230 5,78589
iokk 179 6,21753
lSVj 180 6,66110
oBcM 227 6,54674
oC3c 182 6,08270
oErv 180 8,30077
oH98 181 7,66408
oHJR 180 8,29478
oHcg 182 6,59863
oMsQ 180 6,53054
oS2V 180 8,27105
oS9p 182 8,30477
p2E4 180 6,52531
p5bI 181 8,59868
p6If 182 6,96445
p6Jj 228 6,92568
p8Hd 181 7,70523
p8gV 181 7,00975
pOBd 182 6,96274
pOFZ 227 6,25783
pPIq 180 6,96377
q211 181 7,00884
qgpH 182 8,60809
r30m 227 6,12573
rkqF 181 8,28698
wLCQ 182 5,88269
wMpl 183 7,80372
wYS6 181 7,00793
wZfB 182 7,10853
wluU 177 5,73536
x1u8 227 6,61358
xjO9 180 6,59329
xjnU 180 6,96178
xqmp 182 8,81407
ysgs 181 6,52787
zh5S 180 8,28891
A0A2I7R243 177 6,19155
A0A2I7R2E0 177 6,29017
A0A2I7RHK5 184 7,59064
A0A2I7S6C9 177 6,05525
A0A4P8NLL7 184 7,61650
A0A9P0VK81 177 6,19195
A0A9P0VKK4 177 6,07395
A0A9P0YF29 177 6,07395
A0A9Y1G4D2 176 5,76941
A0AAE7Y0Y3 177 5,94311
A0AAE7Y2S7 186 7,61656
A0AAE7Y3A6 186 7,61656
A0AAE7Y3D9 186 7,61656
A0AAE7Y4F1 186 7,61656
A0AAE7Y6E4 186 7,61656
A0AAE7YAP9 186 7,61656
A0AAE8C5Y0 186 7,61656
A0AAE8CBB3 186 7,61656
A0AAE8CC24 186 7,61656
A0AAE8CDG6 186 7,61656
A0AAE9BP85 176 5,58514
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_6329
79LaP
54 42,9% 184 3.186E-54
2 phalp2_21590
2ns10
22 38,7% 186 2.198E-47
3 phalp2_11016
4Prl3
67 32,9% 182 4.196E-44
4 phalp2_80
4Ur7q
2 34,4% 183 7.874E-44
5 phalp2_40411
4aXVp
16 32,9% 188 5.201E-43
6 phalp2_7941
wIlS
251 32,6% 190 9.759E-43
7 phalp2_18510
6QgEm
6 48,3% 122 1.656E-41
8 phalp2_36343
kBxJ
714 33,5% 194 3.845E-40
9 phalp2_12459
y0JW
12 45,2% 117 1.363E-36
10 phalp2_1943
4rYA7
14 33,1% 181 1.867E-36

Domains

Domains
Representative sequence (used for alignment): 4t88M (183 AA)
Member sequence: 3HRb (184 AA)
1 183 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01520

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (4t88M) rather than this protein.
PDB ID
4t88M
Method AlphaFoldv2
Resolution 96.46
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50