Protein

Protein accession
3H7Lj [EnVhog]
Representative
1xyPq
Source
EnVhog (cluster: phalp2_39945)
Protein name
3H7Lj
Lysin probability
94%
PhaLP type
endolysin
Probability: 96% (predicted by ML model)
Protein sequence
MLDLIKANIRKEEGLKLQAYKPIKSEKYYTIGYGRYGPSIKEEDVITLEQAEQFLTEDVNSRLKEINNLLPDFNSYPLEVQVALFSEYYRGSIGQSPKTIKLLNEKKYREAAIEFLNNKEYKNAVELGKPGIRKRMEEVSKAIKILEDINNAPLH
Physico‐chemical
properties
protein length:155 AA
molecular weight:17942,4 Da
isoelectric point:7,78
hydropathy:-0,63
Representative Protein Details
Accession
1xyPq
Protein name
1xyPq
Sequence length
181 AA
Molecular weight
20501,15460 Da
Isoelectric point
9,01611
Sequence
MAESFMSSIIPEEKGPTILSKNIKSGTKKKENTTEKDLSVFVNHIKKLEGKKLTAYKPVNTEEHYTVGYGHYGPDVKKGMTITDEQAESYLKKDIEKRLVTIKKAIPNFDNMPIDTRKHLLDSWFRGGLSGSPKTIDLINQENYAEASTEFLDNNEYKNTKLTGVKKRMEATSQAIARLEI
Other Proteins in cluster: phalp2_39945
Total (incl. this protein): 194 Avg length: 168,1 Avg pI: 8,16

Protein ID Length (AA) pI
1xyPq 181 9,01611
14bLS 209 5,52995
1AAS6 167 8,08435
1B6No 197 9,69277
1EEci 121 6,18348
1KHL 212 5,06921
1OO8f 197 9,02553
1Oj84 169 9,17451
1Onm1 169 9,17451
1P7zY 138 7,91125
1PoAZ 140 5,52347
1QZf 159 5,05835
1UNx 214 8,68313
1Wzcs 148 9,37378
1YQT0 156 5,47828
1Zla9 140 4,97201
1gIY0 194 9,58073
1tA6W 200 4,50855
1tFGF 248 5,49584
1uXdm 213 4,65764
1ucq9 148 6,95734
1wvDm 196 9,69187
1xnFk 174 9,85324
1y0SJ 196 9,83164
1zuYP 213 4,45353
21Y2T 213 4,46484
228hE 248 5,42377
24diR 138 5,48288
262kg 188 8,99896
26aRK 220 9,17329
26n80 222 5,18516
26qD9 297 5,41814
281Eg 148 9,35399
2ANyg 176 9,77239
2B6Ki 181 7,83686
2C88W 183 4,84270
2HEPr 214 9,00709
2NZmM 169 9,19624
2PovT 170 9,98791
2USKr 156 5,34334
2kXU7 213 4,40362
2n33I 117 5,84222
2nSql 170 9,95226
2oMz4 138 9,45256
2qpI 130 9,43400
2vubx 142 6,83855
2xhmW 169 9,98533
34ZgF 200 5,32322
35JRK 173 9,86536
35o53 148 5,02567
38isV 115 9,15814
3BH31 172 5,21386
3GWZW 189 9,09625
3Ioqb 148 9,75447
3Irt9 155 7,77190
3KV4Z 155 6,64234
3KqDQ 183 4,94763
3QnK1 170 5,42712
3RWfi 179 5,09206
3RYKb 161 9,18334
3Rcxj 173 9,83106
3evyc 191 9,01502
3hIKW 198 5,51215
45WgV 148 9,45108
46ojp 148 9,37346
49B7y 148 9,13003
49Lgt 148 9,35419
4Cp0E 148 9,48796
4WT1z 198 5,10644
4aPnf 148 9,33575
4br1j 148 9,35438
4nbtJ 148 9,35438
4ncDV 148 9,35438
4pgw5 148 9,49421
4ppxV 148 9,43213
4sX97 212 4,51992
500M4 148 9,54005
50OxI 148 9,35438
51fI6 148 9,47274
520O3 148 9,30100
527HY 148 9,47274
52oyE 148 9,39461
541mN 148 9,37398
54l8c 148 9,56796
56QII 148 9,28088
56qdO 148 9,49421
56tGR 148 9,35419
57ujY 151 9,37295
58XLA 148 9,35438
58u9A 148 9,37372
58wAx 148 9,39428
59EXm 148 9,37398
59KqP 148 9,48796
5ALqK 148 9,39403
5AjHd 202 7,76753
5BRzT 148 9,35438
5BT4j 148 9,41543
5C4ww 148 9,46243
5C79l 148 9,26142
5MLsg 141 9,20559
5N9R5 148 6,83690
5S4hE 148 7,77658
5VDLv 141 9,20559
5YBm5 141 9,18547
5ZBea 148 6,83741
5aLY6 148 9,35438
5am8t 148 9,37398
5baD1 148 9,45179
5bcUT 148 9,59568
5f0by 148 9,34374
5f9bw 148 9,32163
5fWOr 130 9,43367
5fWU1 148 9,33555
5h2xP 148 9,43213
5hKQC 148 9,46243
5lMrW 148 9,35419
5lWNc 148 9,37372
5mRkc 118 9,05653
5nV2J 148 9,59568
5s6m8 161 8,58269
5uqeF 148 9,41317
5vP5B 148 9,35438
5vpmg 147 9,13003
5wKKx 148 9,41569
5wZ6Z 148 9,45205
5wexs 148 9,56796
5yCoK 177 9,21854
5yDt7 204 7,76753
5ycvY 198 6,47211
6GhEu 148 9,41517
6HiJR 148 9,62547
6JBWS 156 4,64269
6JYRg 173 9,81584
6KYUB 148 9,43213
6MpqJ 156 5,47066
6NKdj 156 4,78689
6Uve4 148 9,35438
6f7ob 148 8,57334
6iOc5 148 6,73965
6kZ4k 148 7,76912
6lav6 148 8,90574
6tPtl 148 7,76906
6v354 148 6,73402
7CeaT 212 4,91262
7ELur 153 8,19801
7IUS3 174 9,83312
7Pvb 152 5,24052
7TG6I 173 5,06676
7UpBg 212 4,62859
7Xbw5 148 9,49453
7p623 196 9,85079
81os6 173 9,90255
89WxH 188 9,47906
8AlZ7 189 6,04314
8BK0u 191 9,13905
8ByRO 155 6,64234
8C1lT 181 7,80482
8E0Ye 161 9,73681
8ESa2 174 9,63623
8EakY 193 6,36275
8EpGx 186 9,39570
8F1rO 225 9,23498
8FnvR 160 5,75889
8GzUy 223 9,32840
8jMY1 148 9,14737
8laxG 155 6,63904
8o5yg 148 9,43213
8xRDB 200 9,19604
8xxeu 191 6,76511
8y3tz 261 8,77165
8yALG 160 4,91648
8ySxb 188 4,69873
8ybXw 200 9,44012
8z2Ae 194 9,33059
8zuqh 249 8,61209
ASWF 203 9,51832
GvzT 148 9,47216
L6DA 148 9,58601
LBkc 113 9,07613
LoQh 113 9,07613
QXUI 223 8,78577
RuZK 159 5,04738
ToCH 173 9,91003
XX6L 161 9,22067
XjAw 185 5,01862
cvY3 191 9,26619
eVGX 195 9,54211
ltcb 249 5,65204
sPtG 181 9,17438
uYSL 189 8,03690
w6Nq 181 7,81307
xSof 194 8,46426
xZVU 181 9,17077
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_20206
81gIU
77 43,4% 145 3.548E-56
2 phalp2_33046
4vJVC
5 64,2% 112 3.438E-46
3 phalp2_34365
48wU2
27 43,4% 152 4.710E-46
4 phalp2_34107
2PzsF
33 36,0% 172 2.115E-38
5 phalp2_31984
55Yxp
114 32,9% 155 8.323E-33
6 phalp2_27215
3rxlo
19 33,5% 182 1.139E-32
7 phalp2_30621
6CSYi
90 35,7% 140 9.225E-31
8 phalp2_21143
HYzl
1 34,8% 155 2.907E-29
9 phalp2_2923
Quxe
66 30,6% 176 2.609E-28
10 phalp2_28329
19yte
1 31,7% 151 1.875E-25

Domains

Domains
Disordered region
GH24
Representative sequence (used for alignment): 1xyPq (181 AA)
Member sequence: 3H7Lj (155 AA)
1 181 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF00959

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (1xyPq) rather than this protein.
PDB ID
1xyPq
Method AlphaFoldv2
Resolution 86.27
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50