Protein

Protein accession
3EZUJ [EnVhog]
Representative
8F2aP
Source
EnVhog (cluster: phalp2_28192)
Protein name
3EZUJ
Lysin probability
99%
PhaLP type
endolysin
Probability: 94% (predicted by ML model)
Protein sequence
MIQIQELTKHFVLGIVSLLLLFNIMAEASDTFPKTFYETVVKVQKEYDKDSFEAKVNPALVTTLASVESAYGEFTNAPTAKAANNYMGRHAIGDELFIATPSGAKLKKYNSIEDNIRDFLKLMKTGSYYKGFRQAVNEGMPIEEQFKNLNNYSTNPKYFDLLYNSYKKRILPIEQTNKAFEGEKSLGEQMNKLKIPFM
Physico‐chemical
properties
protein length:198 AA
molecular weight:22586,7 Da
isoelectric point:8,52
hydropathy:-0,38
Representative Protein Details
Accession
8F2aP
Protein name
8F2aP
Sequence length
192 AA
Molecular weight
21573,41530 Da
Isoelectric point
6,16631
Sequence
mtliqelikhfvlgivsailfigitmadiaktkdfmkaveevrqeypedsierkipasfittvasvetgnfnfknadtaneaknyfgihasggqkfltttggaklrsfddskgsirafmqlianderytdavnaidrgpeemfkgmsvyaenpnytnllgnvyknriqpifqtenfllpkrkpiveqmdslk
Other Proteins in cluster: phalp2_28192
Total (incl. this protein): 255 Avg length: 191,0 Avg pI: 6,53

Protein ID Length (AA) pI
8F2aP 192 6,16631
12rNj 167 5,32822
1A1nT 196 5,68040
1A8tb 190 6,32728
1AlhB 190 6,84867
1AltZ 201 5,67892
1FeJX 197 7,74968
1PXJR 181 8,81246
1UjbX 190 6,16626
1iGG9 201 9,14041
1ilUN 201 9,23647
1rZXE 192 5,18806
1tCqY 194 5,56553
1tEEk 199 5,31032
1tZLb 194 5,56553
1ttdj 192 5,09706
1upKJ 199 5,48447
1usaH 190 6,74903
1yujP 190 7,85317
1zTOn 192 5,05437
1zXe1 190 5,51687
28WK3 192 7,82287
2AM7K 191 5,78794
2MiZN 194 5,94839
2uWhH 192 5,35113
2xBOz 190 5,53620
2xBVG 191 6,16978
2xF9o 190 5,19965
2xFYn 191 6,15557
2xHUY 190 6,75136
2xN4V 192 5,16117
2xQOx 192 8,02659
2xRTT 200 7,81694
2ymak 147 6,63342
2zY5O 191 5,77668
2zbvs 190 7,84311
36cFZ 165 9,44180
3AL8g 201 6,32274
3ASUp 206 6,50525
3BASa 190 6,17939
3BCj2 199 7,89772
3BCzL 194 5,92986
3BJMw 193 5,78851
3BJTH 163 7,79147
3BtEm 200 6,84747
3Bxnm 190 5,31447
3CCGH 198 9,22157
3CGzL 190 5,70978
3CT8V 191 5,91992
3Cdzu 190 7,87103
3CiSs 191 6,15745
3CikD 190 5,31447
3Cn6X 190 5,65198
3CuEj 190 6,16904
3D1I7 207 9,01218
3DBqb 192 5,56553
3DIgb 192 5,32817
3DKXo 174 6,83076
3DeQA 192 5,55836
3DewF 190 6,17416
3DlYX 200 6,32592
3DroU 193 4,97343
3E48a 200 7,81694
3EDrN 192 5,55836
3EG8n 195 5,65630
3EGd3 193 6,75323
3EIEl 192 5,54006
3EMaL 192 5,01550
3EW8f 190 7,76349
3EWc4 190 6,17922
3EgTF 197 8,96022
3Eu6B 199 6,63427
3Ewpa 192 6,15307
3F8o7 190 6,75312
3FPGf 200 7,82500
3FQRy 199 6,75534
3FRWe 195 5,93225
3FU07 190 8,66869
3G5pJ 168 5,68085
3G9yv 200 4,94763
3GWu5 191 8,92244
3GyOZ 192 5,57922
3HgRQ 193 5,12980
3HjX7 190 5,71717
3HkJs 192 6,15654
3Hlw6 193 5,10200
3HunF 190 8,61518
3HxM9 200 5,97670
3I6uj 200 5,47589
3IKjg 192 5,32481
3Ij0k 200 5,79493
3Ijc5 198 5,78015
3Ike8 198 8,52403
3IldN 180 9,30029
3ImUq 200 5,82130
3Ioas 193 4,97343
3Ioc7 192 7,74166
3ItJD 200 6,32603
3J9ar 191 6,62296
3JCEz 199 8,75224
3JS4p 190 6,75096
3Jb0h 197 7,75604
3Jkei 165 9,69632
3JzFM 188 5,68932
3K58w 200 6,85003
3K6IB 200 5,49914
3K6P9 176 5,60020
3KLd2 223 6,22742
3KWQc 191 8,61389
3KkzP 165 9,32324
3KolL 192 5,96550
3Kq0k 197 8,80646
3KqKr 184 5,19948
3KyYI 197 5,96857
3L07p 165 9,44173
3YWK3 192 5,55836
3oFjj 213 7,71575
3oLQM 190 5,68961
3oMHg 198 6,95922
3oMrH 172 5,91986
3oOzp 190 5,57059
3ocBl 190 6,17416
3ohyU 192 5,33817
3om2P 200 5,98727
3omn2 197 8,85275
3ozQj 200 6,18121
3rEC8 192 5,19090
3xdke 200 6,32177
3xgJ3 191 5,79442
3xgKt 200 5,69199
3xgnD 192 7,75644
3xiM4 197 5,78856
3xjRY 191 6,62694
3xjcB 192 5,92924
43aFx 197 6,75301
4POsS 165 9,34522
4Pb7z 189 7,97289
4PhFf 197 8,64819
4R6iH 172 5,92657
4R8D2 192 5,61600
4RZNv 169 5,29082
4S7Ul 179 6,80956
4UQ9m 190 5,58155
4Ux1L 191 5,78021
4UxBF 169 5,93919
4UxrT 195 5,00134
4V3er 180 5,95862
4Ykp3 201 9,12616
4YyHN 181 8,53486
4tH4 192 5,76156
5dlh2 201 8,98884
5j7sK 181 7,74019
5oQFP 139 8,81523
5oTHQ 187 5,31714
5p3Uj 172 7,82177
5pEa4 192 5,42064
5pYvu 187 6,80712
5prNw 194 5,09064
5puue 167 5,15594
5q7Iy 156 5,10473
5qBu5 192 5,18056
5qNfH 167 5,15594
5qj1V 189 6,19490
5qkeA 167 5,15594
5qrk5 212 9,68310
5qwPN 182 5,09206
5qyMn 188 6,80888
5rHnv 186 5,69262
5rShP 192 5,16697
5rVS9 241 9,86916
5rl2V 186 5,69256
5rv6q 179 6,92966
5sbKw 181 6,79518
5svOH 187 8,66373
6VssZ 166 5,61088
7D1W3 154 6,57595
7GLex 192 5,76156
7IPoJ 201 5,95453
7ISK2 192 5,32481
7ISRK 190 6,15546
7IpgF 198 5,36039
7VQHv 191 6,16734
7W339 198 5,34778
7WadR 200 6,16961
7WhUT 190 6,75096
7Zqcb 190 8,66785
82brX 199 5,48777
82no7 198 5,51994
83Rtz 196 5,20204
83szk 190 5,94424
83uq6 190 6,84895
841io 174 5,57064
84jZm 200 7,80159
84k7u 192 5,56200
84tgp 190 6,31432
85cgu 190 8,98027
85ots 190 6,75096
8AMzC 191 6,16734
8Ar5T 199 7,88553
8Bg6N 197 5,78856
8BjXN 199 8,75224
8CTPm 200 6,16961
8D64e 190 6,17416
8EwaN 192 5,93873
8FGee 190 8,61518
8FHgM 193 5,28167
8FOmx 193 5,12980
8FSpl 192 7,75644
8FvuH 190 5,94424
8GSeI 200 5,47589
8GsRI 200 6,32717
8bUYi 200 5,97130
8cBTl 191 5,54933
8cH5Q 199 9,07052
8gBKs 191 6,16978
8gOm1 200 5,81374
8gTnD 200 6,75369
8glgl 197 6,75079
8gpJk 191 6,75073
8gqgm 190 8,68745
8guhb 190 6,60835
8hu9K 205 5,46310
8ifB1 198 8,90600
8ifYz 191 5,18806
8itEH 197 9,11559
8lCLC 198 8,52403
8o36h 172 5,53631
8o3PC 190 6,75465
8oXNv 201 5,45276
8qLy8 198 8,52403
8qwGb 200 5,80596
8qxeN 191 6,16978
8sQuK 201 5,46310
8st2b 181 8,54898
8uGtZ 201 5,94868
8uUOl 192 5,19090
8v2zL 200 6,18121
8xo9Y 190 6,75096
8ydTd 200 7,81694
8yj3T 195 5,94493
8zNN1 192 5,96550
8zO70 200 6,18121
8zRjE 201 6,32274
8ziI1 199 6,75534
8zjJL 192 5,55069
9d0S 192 5,32481
9gf1 192 5,19090
9pVP 194 7,97701
NUGv 172 4,90170
R7nu 172 4,90170
VA3y 172 4,69077
p38y 192 5,34562
w2If 192 6,15665
wa7e 200 7,81694
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_40591
7CN2j
1 65,5% 122 8.784E-54
2 phalp2_8561
1Ibzf
44 26,3% 144 2.134E-08
3 phalp2_24548
7J4ML
47 25,6% 144 4.337E-07
4 phalp2_20226
8kJAz
18 26,0% 138 4.757E-06
5 phalp2_21183
12C1W
594 25,3% 158 2.841E-05
6 phalp2_4384
2huub
3 23,8% 176 2.841E-05

Domains

Domains
Disordered region
GLUCO
Representative sequence (used for alignment): 8F2aP (192 AA)
Member sequence: 3EZUJ (198 AA)
1 192 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01832

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (8F2aP) rather than this protein.
PDB ID
8F2aP
Method AlphaFoldv2
Resolution 84.90
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50