Protein
- Protein accession
- 38nDt [EnVhog]
- Representative
- J8O2
- Source
- EnVhog (cluster: phalp2_37034)
- Protein name
- 38nDt
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 97% (predicted by ML model) - Protein sequence
-
MGQRLDFIEVAKSQLGVIEGPKDNETKYGAFTKANFLPWCGSFVNWCANEVNLKIPNCVSTVNGASAFMKKKQWEKASDTAQPLPGDIVFFDFPNDGVDRISHIGIVVKDNGDGTVTCIEGNTAPDKKGDQRNGGQVCLKVRAFKKKNGSKLRRSQAVTVVGFGKPVFKS
- Physico‐chemical
properties -
protein length: 170 AA molecular weight: 18514,0 Da isoelectric point: 9,34 hydropathy: -0,39
Representative Protein Details
- Accession
- J8O2
- Protein name
- J8O2
- Sequence length
- 196 AA
- Molecular weight
- 20918,68140 Da
- Isoelectric point
- 6,13261
- Sequence
-
MGQRADFIAVAKGELDVIEGPKDNETKYGAFTKANFLPWCGSFVNWCANEVGLKIPNVVSTVAGATAFIKKGQWEKVNEATPLPGDIVFFDFPNDGVDRISHVGIVVKDNGDGTVTCIEGNTSPDKKGDQGEQMFDKEKLKQIGLSYLRAAAASVVALYTAGQHDPKVLASAFVAGLIGPIMKALDKSAPQFGLKK
Other Proteins in cluster: phalp2_37034
| Total (incl. this protein): 142 | Avg length: 169,1 | Avg pI: 9,09 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| J8O2 | 196 | 6,13261 |
| 16n0m | 170 | 9,24859 |
| 17Uqi | 170 | 9,30055 |
| 185zI | 170 | 9,22377 |
| 18prQ | 169 | 9,08264 |
| 19MQj | 169 | 9,14170 |
| 1LJHo | 170 | 9,24091 |
| 1chZh | 170 | 9,22377 |
| 1ciGY | 170 | 9,22377 |
| 1ey1M | 170 | 9,11243 |
| 1zjSK | 170 | 9,24111 |
| 1zqew | 170 | 9,22357 |
| 21bVz | 169 | 9,08264 |
| 24xf3 | 171 | 9,30151 |
| 24ybd | 170 | 9,30029 |
| 2RXdy | 169 | 9,06865 |
| 2cZ22 | 170 | 9,09728 |
| 2jih2 | 170 | 9,09728 |
| 30h4V | 170 | 9,09728 |
| 30kYT | 170 | 9,08451 |
| 31Kht | 170 | 9,09728 |
| 31OyA | 170 | 9,09728 |
| 34wL2 | 164 | 9,09966 |
| 35OPl | 170 | 9,05189 |
| 36K8o | 171 | 9,11243 |
| 38byc | 170 | 9,31808 |
| 38f8C | 170 | 9,21152 |
| 38fnD | 170 | 9,24111 |
| 38hw6 | 170 | 9,24111 |
| 38lZM | 170 | 9,43432 |
| 38ntJ | 170 | 9,33704 |
| 3VOa8 | 169 | 9,17451 |
| 3boUF | 171 | 9,11243 |
| 41K8y | 169 | 9,14170 |
| 46FPi | 169 | 8,95242 |
| 46L84 | 169 | 9,15775 |
| 46RPC | 160 | 8,95738 |
| 46WJU | 170 | 9,11262 |
| 47DwI | 170 | 9,09728 |
| 47LTT | 170 | 9,33684 |
| 47yfy | 139 | 9,32260 |
| 484DD | 169 | 8,93978 |
| 48DQk | 169 | 9,22357 |
| 48VOL | 169 | 9,06865 |
| 48f6k | 169 | 8,94152 |
| 494af | 170 | 9,20713 |
| 498si | 169 | 9,14150 |
| 49BHe | 169 | 9,02991 |
| 49CPU | 166 | 9,08264 |
| 49F8z | 170 | 8,88183 |
| 49TJn | 170 | 8,95255 |
| 49a5P | 170 | 9,09728 |
| 49cAY | 170 | 9,13686 |
| 49cfT | 170 | 9,03842 |
| 49mV7 | 170 | 9,11262 |
| 49taW | 170 | 9,05189 |
| 4CiGz | 170 | 9,48654 |
| 4OuNX | 170 | 9,24111 |
| 4RCfQ | 170 | 9,22377 |
| 4RwjI | 170 | 9,17451 |
| 4V6Rp | 169 | 9,23756 |
| 4aJZs | 170 | 9,08264 |
| 4aNf7 | 170 | 9,24111 |
| 4aoY0 | 170 | 9,08264 |
| 4axfQ | 169 | 9,08264 |
| 4axpF | 170 | 9,20713 |
| 4b4je | 170 | 9,12835 |
| 4b65U | 169 | 8,93978 |
| 4bLFP | 125 | 4,69288 |
| 4bMmE | 170 | 9,24143 |
| 4bW6d | 170 | 9,08264 |
| 4bZBY | 170 | 9,11269 |
| 4buk5 | 170 | 9,22357 |
| 4bv4A | 170 | 9,20713 |
| 4m9xH | 171 | 9,26328 |
| 4n6b0 | 169 | 9,14170 |
| 4zowF | 170 | 9,11243 |
| 54lq6 | 170 | 9,24091 |
| 54vxh | 170 | 9,46887 |
| 55sSj | 170 | 9,25967 |
| 5C4Zl | 170 | 9,16645 |
| 5Dy8x | 170 | 9,26335 |
| 5a5qv | 169 | 9,15775 |
| 5aOre | 170 | 9,09728 |
| 5eHZM | 169 | 9,15775 |
| 5ibgB | 170 | 9,11243 |
| 5jIhp | 169 | 9,15775 |
| 5jTZ6 | 169 | 9,02991 |
| 5kVNV | 169 | 9,15775 |
| 5laE0 | 169 | 9,26309 |
| 5nYek | 170 | 9,20713 |
| 5uvBd | 169 | 9,15775 |
| 5wSlE | 170 | 9,06865 |
| 6Apwn | 170 | 9,09728 |
| 6AyR1 | 169 | 9,08264 |
| 6GipE | 169 | 9,02991 |
| 6GwNT | 169 | 9,17471 |
| 6II0n | 169 | 9,01521 |
| 6KVwd | 169 | 9,24601 |
| 6M5Ju | 170 | 9,09728 |
| 6MnrZ | 169 | 9,08264 |
| 6xsgp | 169 | 9,15775 |
| 6xxKb | 170 | 9,20713 |
| 6ybQs | 170 | 9,22357 |
| 6yzXE | 170 | 9,31834 |
| 7Vygw | 170 | 9,17490 |
| 7XJml | 170 | 9,22377 |
| 7XN3I | 170 | 9,11269 |
| 85CJM | 169 | 9,02991 |
| 87r6p | 170 | 9,09728 |
| 87uIi | 170 | 9,22377 |
| 87wGN | 170 | 9,08264 |
| 883jJ | 170 | 9,11262 |
| 88f6x | 166 | 8,96570 |
| 8msWX | 170 | 9,11262 |
| 8mwQ2 | 170 | 9,09709 |
| Cfdd | 170 | 9,12848 |
| FOPt | 169 | 9,00096 |
| FXw5 | 170 | 9,03823 |
| FYlJ | 170 | 9,30035 |
| FdXM | 170 | 8,95235 |
| Fo2L | 169 | 8,93978 |
| Fytu | 170 | 9,08264 |
| G0t7 | 170 | 9,20713 |
| GgRZ | 169 | 9,00096 |
| GnIS | 170 | 9,09728 |
| GyFc | 170 | 9,09728 |
| IPLC | 170 | 9,09728 |
| KTAx | 170 | 9,20694 |
| Q7sB | 170 | 9,09734 |
| QxVg | 170 | 9,34168 |
| SxZN | 170 | 8,73071 |
| THZC | 169 | 9,23776 |
| U720 | 170 | 9,09728 |
| UcDb | 169 | 9,06865 |
| hWln | 170 | 9,19127 |
| uIsn | 170 | 8,95235 |
| A0A6J5MU15 | 167 | 8,86996 |
| A0A6J5N7V8 | 167 | 9,01534 |
| A0A6J5RKL6 | 179 | 8,83122 |
| A0A6J5SNY4 | 152 | 8,99329 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_12059
59yJo
|
3039 | 71,9% | 139 | 7.512E-70 |
| 2 |
phalp2_17860
jW87
|
92 | 44,2% | 138 | 2.747E-32 |
| 3 |
phalp2_32427
U2OC
|
884 | 44,2% | 131 | 6.646E-26 |
| 4 |
phalp2_24157
2dFjl
|
298 | 38,3% | 146 | 1.241E-25 |
| 5 |
phalp2_18705
oeYw
|
31 | 33,7% | 169 | 9.177E-21 |
| 6 |
phalp2_16018
3yVVm
|
206 | 34,8% | 155 | 3.804E-19 |
| 7 |
phalp2_15515
8mtdC
|
92 | 32,1% | 146 | 1.884E-14 |
| 8 |
phalp2_552
ESm7
|
27 | 31,7% | 170 | 2.562E-14 |
| 9 |
phalp2_31351
2tjAl
|
675 | 29,4% | 173 | 4.737E-14 |
| 10 |
phalp2_26777
3lq1V
|
3 | 37,1% | 121 | 8.754E-14 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(J8O2)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50