Protein

Protein accession
37x0X [EnVhog]
Representative
5eP1K
Source
EnVhog (cluster: phalp2_16312)
Protein name
37x0X
Lysin probability
93%
PhaLP type
endolysin
Probability: 89% (predicted by ML model)
Protein sequence
MNSYPQVYPQASVDNETHRGQSLTDCQCSSLYLKDKILKIKINKKIIKIKNKKNLLAIPMSIMILTISTTTEAKAVSQTDLLKLYAHSRLVSMEQFSCFDALITKESNWRVDAKNGSHYGLGQMRNQTYRRLDGFNQVDWSMRYITKRYGSMCNAWRFFKANGYH
Physico‐chemical
properties
protein length:165 AA
molecular weight:19146,9 Da
isoelectric point:9,72
hydropathy:-0,50
Representative Protein Details
Accession
5eP1K
Protein name
5eP1K
Sequence length
193 AA
Molecular weight
22304,12400 Da
Isoelectric point
9,62527
Sequence
MHEMRSHGRGIGRVKVMRGYTQALHTGVDNPLDTPKNEREVDIDLHGGCTLDAYNTQSLSHLISENESFSYLSKIKKMINKKTNWLMLIGSLIAMQGVDSAHAANSTDSLRLYAHSRLVNFEQFLCFNKIITKESNWRVNAKNGSHYGLGQMKSKWYRNLDGFRQIDQTIKYISVRYSTPCKAWSFHQRNNWF
Other Proteins in cluster: phalp2_16312
Total (incl. this protein): 178 Avg length: 170,2 Avg pI: 9,80

Protein ID Length (AA) pI
5eP1K 193 9,62527
12XUm 137 9,67620
17R4J 161 9,70947
18rG9 174 9,92376
19Gq8 134 9,74770
19H9Q 199 9,72346
19PqC 135 10,08481
1JBVI 163 9,70825
1JE6n 139 9,65364
1Mkzl 174 9,97199
1aDH3 134 9,79483
1aDMo 169 9,75918
1aQBZ 174 9,64287
1aYVH 174 9,61328
1ayek 175 9,76975
1cL3f 174 9,91938
1sn58 199 9,60110
1snZM 170 9,84621
1xWmx 154 9,79882
1ycdd 163 9,70741
25M6d 154 9,79470
280DL 175 9,91319
2GAw8 192 9,81958
2VVMg 175 9,91886
2Ytc6 170 9,84621
2j6Zo 174 9,80508
2j74f 175 9,68343
2jmR5 134 9,83744
2jmm0 172 9,82803
3075f 175 9,78554
30MZC 174 9,70831
30OvJ 170 9,46810
30fnp 162 9,60645
30qmJ 174 9,63514
31nVL 162 9,59233
31oEW 168 9,70663
31qy1 168 9,58672
31xZn 174 9,77832
320J1 171 9,76350
3292b 167 9,64558
32Rsm 174 9,68646
32Ymw 167 9,75956
33YwF 176 9,78451
33zCr 174 9,85169
363IW 167 9,79412
37dp7 174 9,70831
37dvr 167 9,68536
37fem 168 9,71811
44kvi 187 9,71547
44qPv 160 9,80417
45TWI 178 9,81526
45X79 185 10,00744
47B4x 176 9,67479
49UXM 178 9,79276
49wzA 185 9,98056
49xks 175 9,78593
4Aup8 174 9,81913
4D9UW 174 9,58646
4Gda7 174 9,51690
4Genc 144 9,81868
4GhVW 173 9,76343
4Gi32 191 9,78451
4GiI9 191 9,80746
4a5s6 174 10,13980
4bKrr 135 10,08481
4bO51 151 9,76904
4ghpW 140 9,39151
4gi17 155 9,73397
4gq3v 191 10,12574
4h0lT 134 9,74319
4lsGh 161 9,90610
4mAqP 176 9,84176
4n2SU 175 9,80817
4n9oA 208 10,00777
4nnzU 176 9,82023
4pcYE 174 9,57151
4qMLV 173 9,75937
4qNHP 174 9,78058
4qnZM 176 9,95136
507Te 167 9,75318
508pz 175 9,76582
50NO5 169 9,70670
50iDs 185 9,95335
51TTZ 175 9,90552
51kF9 185 10,12942
52Uw4 162 10,17087
52dL7 135 10,08590
52zAf 174 10,03317
53W7t 161 9,83422
53y1e 174 9,72946
54yKI 175 9,85743
553BT 175 9,72765
55Cdi 169 9,64133
55fFd 173 10,10814
55j8r 174 9,56796
56CFB 140 9,81939
56Dcg 166 9,68639
56HDK 174 9,69645
57u5t 208 10,01234
58N69 178 9,69555
58r3E 174 9,75531
58tTp 185 9,83125
592FP 178 9,69580
59mJq 167 9,72662
5AUpx 210 9,76311
5C3H9 175 9,74796
5CtGy 174 9,75247
5DLqh 174 9,76614
5aMRo 169 9,68581
5b417 173 10,00306
5bZgn 173 10,20820
5d7SE 174 9,69587
5eU6I 178 9,43961
5eody 174 9,77690
5fP7J 175 9,80778
5fj73 175 9,80778
5go33 185 9,77671
5gyZe 178 9,83086
5hDXQ 174 9,70670
5hOxB 174 9,94414
5hwhB 178 9,83808
5iAsT 174 9,56796
5ih3s 168 9,83164
5kOGo 191 9,83454
5l5b5 165 9,73371
5nlJA 168 9,75318
5tlKU 175 9,70702
5tvt0 167 9,83164
5uaHv 167 9,70709
5vYyO 178 9,73855
5w9OR 185 9,98108
5wPQS 185 10,03452
5wbKB 185 10,05895
5wtca 174 9,62096
5x0TY 128 9,82268
5y2Zk 166 9,79431
5y4VF 160 9,73255
5yspE 175 9,74796
5zimj 168 9,64101
6Agko 176 10,05586
6Ggys 173 9,79928
6IDCS 174 9,76001
6IsLy 174 9,90378
6Iyhe 171 9,63514
6PCiw 174 9,75318
6Upqd 185 9,89791
6xCFg 161 9,80553
6xbxX 186 10,00416
6yIHT 167 9,68613
6zmy5 176 9,68613
7XKAS 174 9,94420
7XKHi 174 9,85942
83FWC 164 9,95838
87JB0 172 9,69606
8mAiB 186 9,94826
8sdd7 170 9,65358
8ssrm 168 9,70741
C7H0 135 10,01608
C8JU 170 9,68407
C8KC 165 9,97979
C8Nt 135 10,04200
C9M1 167 9,77871
CfzW 169 9,77084
Q9Zm 174 9,81997
RZTd 169 9,77761
SpLa 153 9,96599
Stiy 174 9,73925
T1WL 167 9,70792
U9yx 165 9,49447
Uc8p 169 9,71772
UcKL 165 9,84015
Uuye 174 9,79431
iOZI 171 10,03555
A0A6J5NRQ8 160 9,75453
A0A6J5NW93 155 9,50865
A0A6J5S5Z2 155 9,93995
A0A6J5T6D7 158 10,07114
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_24722
6xRGD
450 34,3% 157 5.048E-30
2 phalp2_39477
5a1kB
101 30,6% 137 1.460E-22

Domains

Domains
Disordered region
Unannotated
Representative sequence (used for alignment): 5eP1K (193 AA)
Member sequence: 37x0X (165 AA)
1 193 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (5eP1K) rather than this protein.
PDB ID
5eP1K
Method AlphaFoldv2
Resolution 70.68
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50