Protein

Protein accession
34kDd [EnVhog]
Representative
uXmy
Source
EnVhog (cluster: phalp2_38340)
Protein name
34kDd
Lysin probability
98%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MSIPTKRGVDLSLLHPRFVKRLEAFFNDPRIIGRVQITSGCRTYAKQKYFYDGYKSRKAGFNLAANPDRRFGPKALNGIGIWRGSWHMEQDDGFCYAVDFGLCGNGIKKWEVNNIAKEYGMHPTVSGEWWHHQPRASSDWFDAPALIGVGVKEETKEPVVDWGALLRYLAALTAEIRTNPIRRKERSDRVKVLQRRLGALGIDCGKIDGIFGWGTKRKVRQFQRINRLTRDGIVGPGTWDEMWGDEPLS
Physico‐chemical
properties
protein length:249 AA
molecular weight:28410,2 Da
isoelectric point:9,74
hydropathy:-0,54
Representative Protein Details
Accession
uXmy
Protein name
uXmy
Sequence length
238 AA
Molecular weight
26845,37380 Da
Isoelectric point
10,83599
Sequence
VTLPTTSSRVRTAELHPRFRARLEEFFRHPEIVGKVKIVSGVRTIADQRRLYDLYKRGRGNLAANPDRQLANGFRGSYHMQQNAPGCDGYGMAVDLRITGRGLTWARLHQIIGTFGIRPTVRSENWHMQPGRMAGNRFDWFPYTAGREKPFQADTRSELQKIAAYIAELRVTVLRRGDRGVHVKSLQRFLEDQSFPAGTADGVFGRKTEKAVRMLQRDAGLVVDGIVGPKTWNALLGS
Other Proteins in cluster: phalp2_38340
Total (incl. this protein): 379 Avg length: 244,8 Avg pI: 9,69

Protein ID Length (AA) pI
uXmy 238 10,83599
10cXk 241 10,22322
12awt 242 10,22741
12jHF 255 10,17293
12sU3 240 9,62205
12xHi 243 10,53647
15Sw5 238 10,93772
16od1 243 10,04735
17mue 244 9,97863
17uWD 251 10,23947
1B5du 244 9,76008
1B7MI 238 10,74290
1M1VH 226 9,45579
1S0XC 247 9,75447
1Sd6n 247 9,59813
1SfEV 243 9,75930
1UCYc 252 10,21510
1UT2g 245 9,65628
1UqIo 244 9,92409
1W2CC 246 9,90855
1W48F 245 9,63836
1W9Ra 250 10,23315
1WdZ2 245 9,64526
1WpUY 247 9,62166
1WvM8 249 9,34123
1Wvr8 242 10,34191
1WxH5 249 9,61077
1WxH9 249 9,69393
1WxXq 253 9,38345
1ZgHr 249 9,86020
1b3kH 211 4,74238
1g1eD 249 9,66615
1g1nl 249 9,34123
1g1yo 258 9,82809
1g65B 257 9,62573
1g6Al 244 9,60213
1g7Xs 244 9,92892
1gakA 257 9,73687
1vNgc 244 9,70431
1y5eR 248 9,86245
228oy 244 9,62476
22iOl 245 9,84131
24gE6 245 9,92924
268xe 237 10,56812
2CG4N 246 10,40302
2Jx4W 235 9,40698
2JxJF 249 9,78168
2MmYv 245 9,88121
2ODd5 175 9,90429
2Oplp 249 9,63095
2QqZk 242 10,16591
2Qrjp 247 10,00035
2QrkE 234 10,24140
2Uol0 242 9,56326
2ahJ8 256 10,13283
2fAQ9 244 9,33787
2fstM 245 9,35896
2uvSv 240 9,62830
2vNbO 252 10,28575
2vQsJ 281 10,18725
2vWKO 240 10,15108
2wF7O 251 5,30543
2wF8i 251 5,20187
2wSmv 214 9,35999
2wpI5 251 5,04903
2ww9j 217 10,41179
2xQO8 250 10,32237
2xUGZ 246 9,82803
2xZiN 250 9,83692
2xsxY 251 5,21295
2xvWM 247 10,00525
2y5pk 261 5,04943
2y9u2 234 9,25181
2yAmp 257 9,69264
2yG6F 229 9,57957
2yLbI 242 9,96799
2yb8p 257 9,88515
2ydn8 254 10,50514
2yft5 238 9,78309
2zCM5 243 10,32263
2zH6p 251 5,04903
2zucK 244 10,32991
36e5e 253 9,66222
3Byxy 240 10,10730
3CAYH 240 10,20594
3CePr 254 10,01795
3EKWi 241 10,20446
3ERZC 202 10,12852
3ERc6 257 9,73938
3Etij 242 10,24456
3FUXv 240 10,12619
3FclT 257 9,64661
3GVT3 241 10,20523
3GVv2 257 9,78135
3GVvS 257 9,58840
3GWuZ 240 10,02021
3GXtr 257 9,82126
3H0n4 242 9,35554
3HZZg 257 9,79038
3HZtK 257 9,57357
3HcZP 262 10,35499
3HePl 240 10,15108
3Hfzr 241 10,17732
3ICVG 250 10,22270
3IGHe 240 9,64668
3IJ5f 264 9,69116
3IKfG 257 9,71605
3ILCx 240 10,22322
3IPCK 253 10,07836
3Iy7l 244 9,86303
3KCFt 243 9,40447
3KEJs 244 9,66054
3KWfy 250 10,27421
3L1of 241 10,14431
3M4x7 240 10,15108
3QQN2 238 9,67073
3R2V7 250 10,09809
3Rgfu 242 9,68981
3SBQc 243 9,62411
3SBSA 249 9,91255
3SC1f 255 9,71630
3SCcC 248 9,83447
3SCfW 249 9,79715
3TcQd 238 9,48622
3U5nF 250 10,10408
3U7ZZ 243 10,42101
3UbNP 243 10,04264
3Vf8e 240 10,13219
3WwCH 249 9,88450
3Yf0l 250 10,20343
3Z3Kg 245 9,88121
3dnoX 236 9,09541
40QRw 253 9,40969
41A0V 285 5,38910
42Ijt 250 10,20343
42TTn 250 10,20343
42VOA 240 10,20523
42q3E 242 9,68891
48w4O 244 9,53747
48yBm 249 10,06785
48yM4 243 9,60742
48yO7 243 9,84524
4D4tT 197 9,62611
4OPJJ 243 9,65848
4OPgG 243 9,67446
4OPna 232 10,00847
4PiLu 264 9,69116
4Pt5a 243 9,75015
4Ptun 243 9,95323
4R8rs 251 10,36350
4RL05 240 10,22477
4Rrv5 265 5,30469
4c4Rf 249 9,86065
4c51d 249 9,94111
4dFKk 242 9,40073
4dFY2 240 9,75621
4dHSq 245 10,09267
4dJAC 243 9,41388
4jkhm 241 10,14122
4rZxq 242 9,56371
4t69z 286 10,30200
4uZK5 226 10,23579
4vKiq 244 9,90358
4wCZe 211 9,76665
4xezL 240 9,57196
5A1GN 245 9,91313
5A6eb 245 9,88779
5AdFW 237 10,34474
5Ag9l 208 9,55887
5Ai1a 245 9,91313
5FjI3 240 10,13219
5I74W 249 10,15076
5dNiW 245 9,86851
5jpGW 245 9,97682
5qVyN 240 10,17803
5qXKL 241 10,41205
5r1C4 295 9,82042
5rGVm 257 9,71534
5rLC0 284 10,02337
5s1yj 253 10,05940
5s3si 241 10,16913
5s5id 264 10,40934
5s73q 246 9,83486
5s7ED 257 10,03059
5s9wd 241 10,22322
5sDgX 240 10,15108
5sVUb 249 9,72230
5sky4 244 9,97450
5ssPQ 231 10,30954
5sx5s 284 5,37847
5td3H 250 9,65441
5tem7 245 9,80211
5yEsq 200 10,70551
5yJ6F 238 10,86790
5ybMP 236 10,37337
5ybky 237 10,44267
6CT61 244 10,65645
6CTdR 244 9,81662
6CTj2 264 9,58124
6CVIs 186 9,51574
6CVoS 250 10,25726
6DAr 240 9,89927
6EaCP 245 9,60149
6N8ft 243 9,73075
6QoIG 243 9,55114
6RD3c 244 9,39074
6RFeo 238 9,96083
6RHNQ 242 9,53766
6RHVd 251 4,97389
6RHac 249 9,85871
6RI9V 266 5,29793
6RIKb 212 9,65435
6V4tg 255 10,01795
6XlkB 207 4,75000
7CQNR 247 10,13722
7CekT 191 10,28601
7Cf08 206 9,63417
7CiRI 250 10,07623
7CiVV 187 9,85884
7ClrR 177 10,15991
7Comu 211 11,19798
7Cscr 246 10,41488
7Cych 245 10,54021
7DgUb 241 10,03097
7H2c1 244 9,65886
7SRyF 259 9,83602
7SZEe 259 5,32669
7T3NY 244 9,53728
7TCef 253 9,44457
7TDG8 246 10,45724
7TgyK 280 10,35970
7TrVb 244 9,83770
7VD3S 246 9,94813
7VSqX 275 10,38555
7XCSo 240 9,55842
7YMdo 244 9,78819
7p7Av 261 5,14077
7p7LS 249 9,88450
81DmR 257 9,76375
81I8J 241 10,15914
81dbR 250 10,21987
86gKP 244 10,17732
8AVwM 240 10,07978
8AvA0 240 10,23760
8B7Lo 249 10,24101
8BJSl 249 9,99352
8BTcQ 245 9,80785
8Bm72 242 9,36270
8BnBd 241 9,93182
8C0Rj 252 10,13986
8C7JP 182 9,46030
8CBv2 246 9,90855
8CIZH 251 10,18647
8CSdU 257 9,62540
8CX1A 240 9,78245
8CcAB 247 9,12797
8Chxr 244 10,60010
8D0cX 240 10,22496
8D1Os 248 9,83447
8DYBC 240 10,15108
8DZRJ 280 10,35970
8Dmsb 238 9,67073
8E8LI 238 9,71921
8EHn8 244 10,53976
8ESV9 247 9,62166
8Eav1 242 10,11375
8EpmQ 245 9,72166
8FCAj 240 9,57757
8FEDg 243 10,44022
8FIWe 241 10,00267
8FLKS 244 9,58659
8FMG6 257 9,58840
8FMMR 240 9,70418
8FPWO 242 10,10131
8FRIY 244 9,95284
8FYdL 236 9,84524
8Faqm 244 10,65645
8FpRo 251 4,95536
8Fs6k 257 9,58840
8G0rc 243 9,92963
8G62h 244 10,08319
8GA6R 226 9,75930
8GJJB 274 10,15018
8GK2g 274 10,09525
8GlVS 256 10,13283
8Gng7 243 10,00222
8Gt9w 241 10,17732
8Gz5j 260 9,96012
8ac8s 252 10,13986
8bGE3 240 10,22477
8bRYX 243 10,23676
8c1QG 251 10,18647
8c2QM 250 10,30322
8cVWi 246 10,50217
8ciVW 244 10,08319
8cj6u 250 10,17300
8hUhu 264 9,90165
8hVtD 257 9,62540
8hX5b 253 10,08597
8i0ph 251 10,12510
8imp0 241 10,28923
8jfKr 244 9,90765
8lI4z 250 9,56100
8rvc 245 9,63817
8sLT0 249 9,99352
8sMUn 244 9,41240
8sPAg 254 9,97656
8t0Fd 250 10,17300
8t0Lc 254 9,65996
8t5iS 251 10,19808
8tkYZ 242 10,32308
8veP4 264 9,90204
8vh9R 257 9,66802
8vlOh 244 9,86374
8wYTO 251 10,04993
8x2Ng 244 9,97863
8xGP0 266 6,39981
8xtjd 246 10,45724
8y2Oq 245 9,62721
8y3NL 251 10,32598
8y6Zm 241 10,00486
8yHsN 241 10,03097
8yPWg 244 9,86303
8yXo7 236 9,66273
8z0tC 253 10,08597
8zHDQ 246 9,82629
8zZkO 238 9,71921
9MEE 247 10,30761
9qOI 240 10,12619
AqC7 173 10,98749
CxnV 252 10,06740
Drgb 266 5,80868
HTnm 238 9,95393
NRQu 252 9,97263
NUzg 240 9,31608
NXy9 196 9,58821
OFI9 254 10,55014
OGY0 240 9,57196
Pn2v 234 9,21171
QWrw 247 9,60581
QZn7 239 9,32969
R8f6 245 9,59555
Rd4c 242 10,09402
RdJP 244 9,65628
VTbJ 243 9,67163
Vfzi 236 9,86387
VgGA 250 10,01898
VhFf 238 5,91395
YAhz 253 10,05670
YBQx 246 9,61051
Yz0c 257 9,70431
YzhR 236 9,79934
Z1DR 247 10,24340
bYYh 236 9,80527
c2aK 236 10,26635
czs5 245 10,58727
fLbT 210 5,27099
g7Kv 251 10,05947
k9en 258 9,90771
p231 247 9,66492
p9Mz 253 9,42839
pcZ1 247 9,33530
phBe 250 10,05206
qQDr 249 10,16352
qToC 246 9,79238
rCI6 253 9,56848
s4ek 257 9,69264
saiU 274 9,68027
sc8H 245 9,63817
sfCS 244 9,31795
tqKu 247 9,53483
uvkT 245 9,92886
v9Nv 244 9,42317
vGzU 255 10,21161
vZ0t 251 10,10563
zJ6n 244 9,68865
zK7T 236 9,39151
zpE3 251 10,35377
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_6484
rVMf
9 44,0% 150 7.046E-64
2 phalp2_15650
2SEqZ
21 24,4% 176 3.475E-17
3 phalp2_38738
13IfP
1 26,7% 209 4.712E-17
4 phalp2_37143
1r1gj
3 27,5% 200 1.335E-15

Domains

Domains
Unannotated
PG_1
Representative sequence (used for alignment): uXmy (238 AA)
Member sequence: 34kDd (249 AA)
1 238 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01471

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (uXmy) rather than this protein.
PDB ID
uXmy
Method AlphaFoldv2
Resolution 93.55
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50