Protein

Protein accession
32Fyq [EnVhog]
Representative
7IJp2
Source
EnVhog (cluster: phalp2_2374)
Protein name
32Fyq
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MHNINRDLDYFTREEFACQYTGDNEISDDLLLKIDLLRARCGFPFVITSGYRSEDHPIERKKEKAGTHAQGIAADIKVSNGTQRYTIVEE
Physico‐chemical
properties
protein length:90 AA
molecular weight:10336,4 Da
isoelectric point:5,32
hydropathy:-0,66
Representative Protein Details
Accession
7IJp2
Protein name
7IJp2
Sequence length
65 AA
Molecular weight
7453,34580 Da
Isoelectric point
6,02450
Sequence
MKYFSKKEFDCQHTGENRMEQAFLDKLDALREHCGFPFVITSGYRSPDHPIEAVKEIPGTHAQGI
Other Proteins in cluster: phalp2_2374
Total (incl. this protein): 341 Avg length: 108,2 Avg pI: 6,09

Protein ID Length (AA) pI
7IJp2 65 6,02450
13TBM 113 5,41246
140GA 113 5,79163
15VkK 113 5,74065
15WCr 117 7,78038
16D1t 85 6,04951
16wA7 124 6,28573
1A24u 113 5,80374
1A3IM 113 5,81329
1A89c 113 5,65539
1AYib 113 5,41655
1AmqT 113 5,22620
1Azd8 113 5,92822
1B8ED 113 6,21218
1Bpa7 113 6,08532
1BrPl 113 5,41655
1D8R 113 6,17302
1ENOl 113 6,38821
1HNAL 124 5,15407
1HkE1 117 6,16745
1N0j2 114 6,20042
1OPO1 113 5,02146
1P1Fx 124 6,18462
1P2kh 82 5,18590
1RCYT 113 5,66096
1SG0v 124 5,17015
1ULXz 113 5,81329
1a0HG 116 6,50422
1a13p 116 7,20954
1ajnz 116 5,81408
1anqP 116 5,66835
1edqa 124 5,91963
1fIR0 113 6,94956
1ftps 47 5,12639
1hXUf 72 7,96625
1haw5 86 6,04667
1rR7Q 116 5,66011
1s4ES 117 6,02598
1sDIj 124 5,91963
1tW8P 115 6,58084
1tb7d 141 5,52079
1uezK 58 4,63041
1usjC 113 6,89550
1uvGg 116 6,05411
1wfe4 63 5,21824
1wu57 113 5,46310
1xKfv 116 5,80311
2156D 114 6,20360
21YOA 77 7,79669
22BZH 104 7,01134
22D3G 115 7,01566
24fRa 116 6,33513
24jTu 113 6,03780
264qw 113 5,91111
26EI7 116 5,43116
26OWx 113 5,41621
26yxU 113 5,65420
27Js2 117 5,45310
28Bpz 113 5,22625
28njL 115 5,12241
29PUK 113 6,17422
29zKm 117 8,86738
29zqX 113 6,20366
2A009 113 5,36233
2AyeS 113 5,65670
2BDra 72 5,50386
2BwbD 124 6,28193
2Bwf6 117 8,64465
2BwtO 115 8,64239
2CLWO 77 10,15882
2FUxJ 117 6,89806
2Fa7l 124 6,18155
2GbL4 124 4,94541
2HXNr 124 5,67153
2HvDf 122 4,97673
2IueI 57 5,21676
2IySz 129 5,68699
2J3U4 113 5,64806
2JLXx 113 5,46310
2JOL7 113 5,91111
2JPJ9 113 5,65545
2JS9N 113 5,46310
2JVYG 113 5,41655
2JX8c 113 6,20042
2Jc2v 113 5,58906
2K19M 116 8,60306
2KbiP 116 8,64058
2Kesz 116 6,27766
2MF9X 113 5,65545
2MH9n 112 6,04127
2MOBO 114 6,07048
2MTlw 76 6,02803
2MWIo 113 6,45688
2MeC8 113 5,65420
2Mnga 113 5,22625
2NLVP 113 5,41655
2Nm0L 117 8,86738
2OGHd 113 5,75122
2Oh6u 113 5,41655
2PE99 113 5,75122
2PIRa 53 5,04130
2PsoA 113 5,41252
2QDHu 124 5,59844
2R5Xu 74 7,76332
2Rksp 117 5,15668
2Rs8C 113 5,41252
2TFUN 113 6,20042
2WToq 124 4,97673
2XbhY 130 5,13895
2Xt4K 124 5,30464
2Y05a 111 5,30441
2YOr7 79 6,71316
2ZaRt 124 5,67392
2ZcVE 124 6,18155
2Zg4u 124 6,18155
2a0XA 124 5,91963
2dA65 124 5,66590
2dGqw 124 5,66590
2dJgm 74 8,50572
2fAkB 113 5,81403
2fG1C 113 7,15975
2fQrT 113 5,41655
2fnWz 113 5,41655
2hhxG 113 5,65545
2iLXj 65 5,47441
2jv7N 124 6,18359
2kS4s 124 5,91469
2kX24 129 5,91804
2mHJu 124 5,17015
2mJHZ 116 5,66011
2mJa5 113 6,20042
2mVD1 124 5,13213
2n1RY 130 5,13366
2oLG1 72 7,83892
2oQTP 124 4,75603
2qVcW 83 6,95234
2uAmL 113 5,75122
2uLjP 113 6,14125
2ucF0 124 4,97895
2vDvw 113 6,04496
2vdEs 114 5,69131
2vdYw 113 5,41655
2vsZa 113 6,03490
2wgeN 113 6,17092
2win4 124 5,17021
2xSZJ 72 5,48510
2zVj1 113 5,48646
32BZm 90 5,32260
34Mrp 113 5,90599
34Mxs 90 5,31049
34Oir 124 6,18359
34Q1F 142 5,79271
34QfJ 124 5,91969
3Bqmr 124 5,59838
3CrUp 90 6,17802
3DEK7 113 5,64544
3DMCO 116 6,27527
3E6Yf 114 5,75616
3FDpt 77 6,40129
3FEin 113 5,66096
3HqYZ 113 6,04513
3IDn8 113 5,41649
3IFt0 124 5,17021
3IGsu 124 4,97417
3KIEy 114 5,92969
3KVXr 113 5,27684
3L19r 113 6,99611
3P0f0 112 7,99919
3P5oF 124 6,28653
3SHRw 93 6,72248
3SJ2C 124 5,90690
3SoGz 124 6,18155
3VmKV 113 5,41655
3VnxD 57 4,79945
3XTRI 77 6,89152
3gvOR 87 6,57033
3rxiQ 116 5,81391
438BE 113 6,12880
438G5 124 5,17015
43aq1 113 5,59520
43dJj 84 6,96144
43m8w 49 5,78924
454jP 81 8,39857
48ovS 116 6,02820
4PWEs 113 6,17518
4Q0IQ 62 4,78854
4R4jA 74 6,39333
4RfPn 113 6,30909
4T29x 114 5,26684
4VHjm 140 8,71298
4VgS8 80 5,25041
4W9Gt 113 6,04138
4WK1R 113 6,17092
4WMAY 113 5,38006
4ibY 124 6,18462
4jnOO 113 6,04741
4qXcA 117 7,77993
4r0Fq 113 8,49605
4sq0T 117 6,49587
4t7BI 124 6,95893
4tDzl 113 6,27437
4tlSF 113 6,06872
4txGo 113 5,65545
4txRO 124 4,99219
4xbKn 116 5,65999
4xcp3 129 5,92299
5AbsB 113 5,64544
5qZZN 78 9,42839
5t7mz 113 6,27204
5tfdT 113 4,82628
5y8yF 113 6,06207
5yc8W 114 5,75122
5ycUO 113 5,65545
5ye80 113 5,58343
6B3Ro 85 8,62672
6Bg1Y 119 7,11700
6Bjll 119 7,14008
6C9pj 124 5,17021
6EcE 117 6,39600
6FQTp 117 6,17740
6FRnL 113 5,19357
6Gb0v 124 5,17021
6Gbnk 108 6,02461
6JNI6 117 6,17422
6JP1t 124 4,97673
6JVvT 124 5,17021
6Jnrk 113 5,22620
6JuGJ 124 5,17021
6JzsU 77 5,04153
6K4v6 113 6,17092
6NEuh 113 6,64155
6NJ1I 70 5,41399
6NLUz 108 5,80613
6NOhL 117 8,60268
6Nfto 113 8,84411
6NpBv 113 4,60404
6O5y2 119 7,14008
6Ogk9 113 4,99833
6OiSY 116 5,44315
6Olc0 108 6,27050
6OnFV 124 5,55797
6Rpar 113 6,49587
71E4M 148 4,83929
7CNWV 57 4,66002
7CQqi 77 6,07151
7CfDi 60 6,90062
7CtEP 116 6,05258
7CvRq 114 5,47737
7DpFS 86 5,04312
7EPNE 113 6,12351
7ESEb 77 5,04687
7ErWj 124 5,67153
7Ferj 124 5,58701
7GzI3 82 8,90677
7IV8E 113 6,02712
7L2AR 63 6,82133
7SIMn 61 7,71177
7TP3O 72 7,82313
7UM3h 114 5,41252
7UVxN 116 6,27863
7UeF 116 7,11797
7Xijg 124 4,97673
7Z14C 116 6,57470
7Z9fk 113 5,75452
7ZNaH 124 5,29014
7rsxS 113 6,20042
80HNV 56 6,70646
80ZuW 83 7,76849
81HeZ 113 7,00963
81yzv 124 5,18243
82E95 75 9,30055
838yS 57 5,49067
83RSF 113 5,22370
83oSE 142 5,53409
83pBU 117 6,03439
85va5 113 6,13142
8ArI1 83 8,97576
8BEns 113 6,89596
8BfzH 76 6,16938
8BqHf 79 7,81481
8CJFF 88 8,49244
8Cd5C 116 6,57470
8CdE9 84 6,80956
8D6e3 81 5,74025
8EGOf 82 7,75849
8F49O 66 5,84864
8FWqO 81 5,72581
8Ftim 84 5,10473
8ctdQ 113 8,58708
8dt3r 116 6,17848
8dtnU 113 5,91901
8eDbT 114 5,41252
8eqg1 113 6,12351
8fAQG 69 5,19852
8ihXq 116 6,57573
8jPwT 90 4,92427
8lu8E 127 5,59366
8nVL 124 5,91963
8pLxf 124 5,55797
8pjSN 117 7,01123
8sCgb 114 5,47737
8tHEs 116 6,03524
8x3rv 116 6,27863
8yjIf 73 5,56206
8yuKq 57 5,49050
8zXBo 76 6,05275
8zt9u 71 8,86442
9hho 114 5,41655
9iOT 113 5,85535
9qF9 124 5,17021
AAF3 124 5,00697
AquI 115 8,39109
B5SS 124 5,91628
B6hP 117 8,63917
PrhX 115 5,28241
Pt4F 119 6,95962
Pxnk 124 5,90605
QnuZ 114 7,91467
RbDl 78 6,89613
RbRm 113 5,22603
WF2n 124 5,11587
WY9o 120 4,97508
WsbV 108 5,75207
Yi6D 124 4,97673
YiAi 124 5,91969
eLny 113 6,38634
gEXv 115 6,26578
gFf9 116 5,26991
gHOr 113 5,65488
gLIs 114 5,20619
gb9h 113 6,04144
ikpv 113 6,30449
k2IW 124 5,91969
vHxk 115 6,96195
vNc9 124 5,17021
vPT5 70 5,19249
wa70 113 5,66409
xDSt 113 6,38497
xJhE 122 7,00696
xLjj 116 5,66823
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_26536
82DSg
12 52,5% 59 4.916E-20
2 phalp2_18054
3DA3W
1 65,8% 41 1.752E-19
3 phalp2_12543
17tRy
38 49,0% 53 3.060E-18
4 phalp2_33162
7IbbY
1 60,4% 43 5.779E-18
5 phalp2_21725
3xK1F
10 46,1% 52 1.909E-16
6 phalp2_25414
2AE54
4 51,0% 47 5.864E-14
7 phalp2_39422
7D36k
12 41,9% 62 7.489E-13
8 phalp2_38403
12owM
41 44,6% 47 1.947E-12
9 phalp2_32684
816WS
5 42,8% 49 3.682E-12
10 phalp2_23438
6BgvO
44 50,0% 48 6.964E-12

Domains

Domains
Unannotated
Representative sequence (used for alignment): 7IJp2 (65 AA)
Member sequence: 32Fyq (90 AA)
1 65 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (7IJp2) rather than this protein.
PDB ID
7IJp2
Method AlphaFoldv2
Resolution 97.28
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50