Protein

Protein accession
30drP [EnVhog]
Representative
8f2S8
Source
EnVhog (cluster: phalp2_1582)
Protein name
30drP
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MTLKEAAERSRGHIERLEASFGARVAKWYSELLDKKIPALIYCSVRTPEEQEELYAQSRTKLGAKVTNARGIPAQSLHIGGHAVDFVPLARTPTGDFVASWDDDKTYAICQKIAEKYNLRHLEWETPHLEDGTISGWRELVSPQKQDVKKSNKSLVSKRPWSSR
Physico‐chemical
properties
protein length:164 AA
molecular weight:18604,9 Da
isoelectric point:9,05
hydropathy:-0,66
Representative Protein Details
Accession
8f2S8
Protein name
8f2S8
Sequence length
172 AA
Molecular weight
19637,01470 Da
Isoelectric point
9,22538
Sequence
MTLKQAQERSLGHIKNLEKGFQKQVAKWFQECWGKKLYVLIYCSSRTQEEQEELYKKGRVPGHPGPKVTNARGYPPQSLHIDQGEGARAIDFVPLVQGGTGSYSAGWDDEEAYEIAHKIAKSVGGLRRLDWETPHLEDASVKGWRELISPQKETEVKKEKKSIFKKNPWSSR
Other Proteins in cluster: phalp2_1582
Total (incl. this protein): 238 Avg length: 167,8 Avg pI: 9,28

Protein ID Length (AA) pI
8f2S8 172 9,22538
14sal 168 9,00980
17MRM 174 8,99271
18BTd 174 9,54811
18DZd 173 9,54856
19AZ8 168 8,99155
19AiN 176 9,35045
19FWc 168 9,19604
19L2x 167 8,71833
19Otc 167 8,81504
19RAr 163 8,48973
19S0s 161 9,49137
19SNy 168 9,32189
19SZS 168 9,42968
19UnB 172 9,63623
1H0hJ 168 9,51362
1JDpw 167 9,20449
1JFxa 167 9,01805
1JYWf 168 9,41169
1JzLP 167 9,22589
1QqAE 146 7,86097
1QukB 149 8,64516
1WMmc 174 9,37191
1Z49o 150 9,01818
1ax31 167 9,47423
1kxOY 174 9,05473
1pZQP 171 9,31937
1wo7t 177 9,64171
27W97 164 8,83167
284M6 173 9,57273
2RXEK 173 9,60348
2VNFY 172 9,70954
2XOqH 168 9,39074
2Yccj 172 9,51607
2cNzs 144 9,18205
2cOMe 173 9,21139
2cWJJ 164 8,50539
2cWvR 168 9,60445
2cY7f 167 9,48396
2d2nM 168 9,19359
2d2xA 175 9,09870
2d3M8 174 9,66583
2d5Wj 161 9,43606
2hBct 168 9,39042
2hDDY 164 8,83206
2hFPX 168 9,39042
2hH1y 168 9,32189
2hI6E 168 9,17206
2hKqC 168 9,17187
2hLI9 168 9,51323
2hO7a 164 8,88550
2hP4L 163 8,81400
2hWbw 168 8,83148
2hzZS 174 9,27902
2iD73 132 9,12274
2iFeR 168 9,63082
2iJvN 169 9,16516
2ivc2 175 9,17361
2jiPG 162 9,09515
2jijo 168 9,71289
30S3u 164 8,83115
30cIv 168 9,51645
30jnE 168 9,48641
31Kk8 168 9,51362
31nDa 167 8,81504
3216r 168 9,51362
322P9 125 9,39577
32eCf 168 9,24807
37dUc 168 9,51362
37dcM 167 9,54836
37jg0 174 9,51568
37jkv 168 9,39042
37oBG 174 9,40763
37tBW 173 9,48564
37tbB 168 9,32189
38aYg 168 9,53966
3b5rN 168 9,33149
3b8Bi 167 6,97104
3bkMp 168 9,17187
3blG7 168 9,09612
3blwv 168 9,64545
467fK 174 9,26683
46jFs 168 9,45211
46tId 174 8,99271
46xLM 173 9,48564
46xWC 168 9,37765
46y5j 168 8,99155
476BN 168 9,18618
4781p 176 9,45727
47COV 174 9,14647
47KAT 173 9,57273
47Mxp 171 9,09702
47gpd 174 9,37804
47viy 173 9,57273
47z1C 168 9,32189
47zRG 172 9,70954
48OVO 164 8,50546
48Z03 164 8,49424
497I6 173 9,48564
498XS 172 9,57318
498tT 174 9,70954
49EQn 148 9,43135
49OGs 168 9,32189
49cUZ 173 9,48564
4BZQm 168 9,32189
4C0S2 148 9,11759
4Dcx7 173 9,67672
4Gc0f 168 9,39042
4IVkg 162 9,09515
4NCq9 168 9,32189
4O26s 173 9,57273
4QV0s 178 9,27979
4aHiz 173 9,48564
4aIGK 168 8,77494
4aJqc 174 9,14647
4aRAH 168 9,15163
4adWF 168 9,32189
4aeXQ 168 9,09586
4aecr 167 9,05499
4aeuI 164 9,05512
4akpZ 171 8,89807
4aoVG 173 9,67163
4avDB 172 9,63669
4b4Rk 168 9,34651
4b5Ov 168 9,34909
4bBJd 174 9,40724
4bPOR 173 9,39158
4bQ5I 168 9,61664
4bSTd 173 9,37765
4bXXP 177 9,47062
4barm 168 9,42633
4brow 168 9,64545
4brto 173 9,48564
4bsYT 168 9,32189
4e4eu 174 8,79782
4f6uK 144 9,51187
4fHsF 168 9,49653
4giAy 168 9,36560
4gjLX 167 9,20475
4gmno 168 9,09612
4nFym 172 9,70954
4pDNe 173 9,67672
4w9JV 144 8,94926
4wmm6 186 9,63914
4zGeH 169 9,45011
52Bea 166 9,96006
53Pj1 172 9,70954
57vmL 166 9,83828
58BiJ 172 9,70954
58jlx 172 9,82874
59GMk 190 9,69316
59H48 168 9,32189
59N62 171 9,09702
5AV78 168 9,32189
5AWRR 168 9,39042
5CZvm 194 9,57821
5DB1V 148 9,51787
5Dz3b 168 9,65712
5aI9x 168 9,45211
5buks 169 9,22860
5cRUN 168 9,48641
5dkru 149 9,67118
5i63m 166 9,80521
5kr2A 162 9,03539
5l56S 168 9,62270
5lW2q 149 9,11804
5nQSD 168 9,39042
5w3tK 179 9,57924
5xVAd 171 9,09702
5zBzr 125 9,48570
5zGZq 143 9,51213
6HMqm 168 9,39042
6L54d 143 9,83164
6MfAx 168 9,43058
6Mrra 167 9,06582
6Qw7e 144 9,02437
6VDmB 144 8,59907
6Y8aV 169 9,95484
6xjwu 171 9,09702
6yZVf 170 9,41176
6yZX1 174 9,57957
6znK8 168 9,82197
6zr9h 171 9,11101
7WJpv 163 9,12874
7WQLx 164 8,83135
7WQXN 169 9,11275
7WQrV 174 8,78280
7WWX8 168 9,43670
7XdT0 168 9,01727
7Xfnm 189 8,38439
7Xgmj 168 9,34909
82Wqb 171 9,33465
82XGd 169 9,43032
82Y1r 172 9,37224
82Y3s 168 9,53779
83nM4 185 8,32772
84Dxl 168 9,20449
87YD5 168 9,34999
87YKZ 171 9,26064
87Z5T 169 8,78396
8bOmQ 169 9,12919
8bS4T 172 9,33446
8eNH8 169 9,26025
8eOCd 169 9,24240
8f2R3 169 9,22551
8f2q8 172 9,18328
8gjeo 168 9,39042
8jCye 169 8,84353
8jMn7 168 9,51362
8kek2 168 9,45211
8lvOO 172 9,22538
8m00R 168 9,27192
8mXnj 169 9,11082
8mt19 171 9,21345
8npM7 162 9,37120
8o6aq 168 8,81542
8r9eG 160 7,75843
8r9p4 172 9,26064
8r9t7 169 9,24220
8rTNq 193 9,69155
8rUe6 169 8,95339
8t4km 169 9,20881
8vMg5 168 9,31699
CaKi 168 8,77494
CaSR 176 9,37765
Ch72 168 8,77494
CiPa 168 9,32189
Cizr 168 9,61664
CjIZ 161 9,35219
LRj9 168 9,51806
RZwz 168 9,32324
SeJP 168 9,06137
Sesl 186 9,20436
T00v 162 9,34136
T4cz 162 9,41646
TR15 168 9,36560
aA8h 168 9,53966
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_1337
15l6q
1516 32,5% 135 1.675E-27
2 phalp2_35414
f7cN
32 29,1% 127 1.625E-21
3 phalp2_34371
4aKCB
348 27,5% 145 5.675E-21
4 phalp2_17541
5IGO5
9 27,2% 121 9.444E-20
5 phalp2_33807
1hNOs
60 26,9% 156 2.140E-18
6 phalp2_13115
8rf6U
1025 29,9% 157 2.923E-18
7 phalp2_714
1GW8q
36 26,9% 156 7.448E-18
8 phalp2_6580
1dlN9
3 28,3% 134 1.897E-17
9 phalp2_15634
2Dd0a
83 27,5% 149 4.828E-17
10 phalp2_27726
6US3d
23 27,6% 130 8.999E-17

Domains

Domains
Unannotated
Disordered region
Representative sequence (used for alignment): 8f2S8 (172 AA)
Member sequence: 30drP (164 AA)
1 172 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (8f2S8) rather than this protein.
PDB ID
8f2S8
Method AlphaFoldv2
Resolution 89.22
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50