Protein
- Protein accession
- 30YVH [EnVhog]
- Representative
- hWzW
- Source
- EnVhog (cluster: phalp2_17848)
- Protein name
- 30YVH
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MALSKITGSQAFAHMHQWLLQHKSIPVGHCHATCQNAWGLPVKYASAIDAWNHIPKKHRHTDMSKAPVGAPVFWAGGLYGHVALQSDRVGVIISTDAPSAGFIGEERVEYFTRVWGKELLGWASQYNDVDLQLGKLPSKA
- Physico‐chemical
properties -
protein length: 140 AA molecular weight: 15398,4 Da isoelectric point: 8,95 hydropathy: -0,17
Representative Protein Details
- Accession
- hWzW
- Protein name
- hWzW
- Sequence length
- 131 AA
- Molecular weight
- 14298,85310 Da
- Isoelectric point
- 9,12397
- Sequence
-
MRDNVNAVIAWSRAEMHAPSRDWSGMCQSHCRSAYGVPAWSDSALHAWGKIPPHHKHAGGDPADAPRGAILYYSGGKYGHAALAIGNDGKNCLSNDYAHRGKIGLAPRTFPRWGLHYLGWSSWTPSGELHL
Other Proteins in cluster: phalp2_17848
| Total (incl. this protein): 180 | Avg length: 139,0 | Avg pI: 9,50 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| hWzW | 131 | 9,12397 |
| 12BbA | 138 | 9,51826 |
| 12DWA | 137 | 8,81787 |
| 12IF8 | 138 | 9,27489 |
| 12PO0 | 138 | 8,44860 |
| 16rM2 | 156 | 8,05379 |
| 17DLm | 137 | 8,55626 |
| 17Kyx | 130 | 9,77929 |
| 17Mup | 138 | 8,88879 |
| 17NhB | 138 | 8,56413 |
| 17ReM | 138 | 8,88879 |
| 17SJu | 136 | 9,54778 |
| 1885w | 136 | 9,64629 |
| 18Jzo | 131 | 9,40724 |
| 18PUW | 138 | 9,09934 |
| 18bzn | 138 | 9,12203 |
| 18fef | 138 | 9,00470 |
| 19W34 | 128 | 9,69735 |
| 1E8nE | 135 | 10,31889 |
| 1JHLS | 129 | 9,67137 |
| 1JoxM | 139 | 9,72913 |
| 1Kb7w | 129 | 9,72398 |
| 1KcSV | 140 | 9,84821 |
| 1Ke6p | 138 | 10,17261 |
| 1aCL9 | 157 | 10,09254 |
| 1cQ5z | 138 | 9,85852 |
| 1jovm | 143 | 9,71450 |
| 1o8xU | 147 | 9,51503 |
| 1o8zP | 147 | 9,29952 |
| 1tMtN | 130 | 9,69780 |
| 1zcC3 | 130 | 9,81049 |
| 22WcK | 139 | 9,70999 |
| 24OhE | 164 | 9,58582 |
| 2T9GM | 131 | 6,54373 |
| 2T9zF | 131 | 6,47234 |
| 2ZBX0 | 138 | 9,30190 |
| 2cLAV | 154 | 9,71456 |
| 2cPqE | 147 | 8,58772 |
| 2iF7L | 138 | 9,56848 |
| 2iGj2 | 138 | 9,49002 |
| 2iLo9 | 138 | 9,51710 |
| 30CYm | 138 | 8,88789 |
| 30TIG | 140 | 8,92992 |
| 30UR8 | 136 | 9,92093 |
| 30ZJR | 136 | 8,90884 |
| 30vCB | 145 | 9,39312 |
| 30zFl | 139 | 9,05267 |
| 31443 | 138 | 9,05757 |
| 315MB | 146 | 9,39209 |
| 3195E | 137 | 9,09902 |
| 32MIs | 128 | 9,75737 |
| 36LVE | 128 | 9,66699 |
| 371Yh | 139 | 9,72862 |
| 37bA4 | 133 | 9,58131 |
| 37u0A | 134 | 9,49079 |
| 37vAY | 138 | 9,54353 |
| 38jRE | 138 | 10,12426 |
| 3AnF5 | 139 | 10,11839 |
| 3T7mW | 132 | 8,48219 |
| 3b1q9 | 157 | 8,56110 |
| 3b2ne | 138 | 8,88789 |
| 3b2sW | 140 | 8,95319 |
| 41QTU | 138 | 9,85910 |
| 443Dt | 129 | 9,51046 |
| 46GrL | 157 | 6,69190 |
| 46XWd | 137 | 8,88866 |
| 46hFd | 138 | 9,85852 |
| 474x2 | 139 | 8,88834 |
| 47AP9 | 128 | 9,69735 |
| 47Ady | 134 | 9,79089 |
| 47Cge | 138 | 9,33001 |
| 47FQY | 138 | 9,14795 |
| 47fKb | 136 | 9,64629 |
| 47psx | 138 | 8,55607 |
| 47pzT | 136 | 8,57141 |
| 47vff | 140 | 8,93050 |
| 48juG | 138 | 7,82706 |
| 490qj | 140 | 9,27502 |
| 490wt | 138 | 9,43986 |
| 497Ye | 139 | 9,57331 |
| 49b0w | 128 | 9,69735 |
| 49fyP | 138 | 9,93543 |
| 49jAX | 128 | 9,85794 |
| 4AavW | 138 | 9,97669 |
| 4BXyk | 140 | 9,66318 |
| 4BY6c | 138 | 9,90146 |
| 4DO17 | 146 | 9,90694 |
| 4Jbpn | 136 | 9,12171 |
| 4NO2t | 170 | 9,48003 |
| 4NRgb | 119 | 9,81152 |
| 4Oqcw | 129 | 9,93414 |
| 4a0zX | 144 | 9,78812 |
| 4aE5U | 128 | 9,66653 |
| 4ap5R | 139 | 9,76627 |
| 4bHNJ | 136 | 9,45082 |
| 4bHfH | 130 | 9,75737 |
| 4bQiw | 139 | 9,69348 |
| 4bVog | 128 | 9,75737 |
| 4bWxj | 134 | 9,65441 |
| 4bg8F | 138 | 9,93543 |
| 4bwuj | 136 | 9,45044 |
| 4e2hK | 166 | 9,48989 |
| 4gjZV | 138 | 9,54076 |
| 4gpbi | 140 | 9,66370 |
| 4nnX8 | 99 | 10,55053 |
| 4o8Kw | 135 | 10,47445 |
| 4oBFy | 138 | 10,08062 |
| 4odPb | 138 | 9,94123 |
| 4oo3N | 138 | 9,85910 |
| 4rCUW | 138 | 9,85910 |
| 4rnQ6 | 138 | 9,57331 |
| 4vQyj | 166 | 9,53715 |
| 51Q4b | 138 | 10,04380 |
| 53YDE | 138 | 10,11362 |
| 56CKm | 138 | 7,67027 |
| 577HA | 138 | 10,04013 |
| 57Liq | 138 | 9,90913 |
| 57a18 | 140 | 9,72546 |
| 58ENp | 139 | 9,47358 |
| 58V7p | 139 | 9,60845 |
| 58s33 | 129 | 9,90204 |
| 59ipP | 138 | 9,85910 |
| 5AyIv | 138 | 9,85910 |
| 5ax61 | 128 | 9,81152 |
| 5eZJm | 129 | 9,92712 |
| 5hKkK | 170 | 9,32156 |
| 5j3hb | 170 | 9,45224 |
| 5o3nl | 138 | 9,94065 |
| 5vTmn | 140 | 9,89720 |
| 5wFmP | 140 | 9,72552 |
| 5xNgW | 138 | 9,89237 |
| 5xrTx | 138 | 9,85910 |
| 6Jn7O | 163 | 9,53747 |
| 6Jyon | 149 | 9,15891 |
| 6Kcpb | 140 | 9,93298 |
| 6M3WG | 135 | 9,96367 |
| 6OO2A | 173 | 9,69290 |
| 6VyWj | 141 | 9,70954 |
| 6xdVR | 138 | 9,84473 |
| 7JWPp | 140 | 9,81281 |
| 7Y1KU | 138 | 9,62347 |
| 806wB | 132 | 9,51059 |
| 87Uhs | 170 | 9,56887 |
| 87ujv | 138 | 9,94065 |
| 87upB | 138 | 9,87051 |
| 87vIJ | 128 | 9,89114 |
| 8bL8i | 138 | 9,85910 |
| 8dZ3v | 143 | 9,81281 |
| 8mVbg | 138 | 9,57847 |
| 8mvxk | 128 | 9,79038 |
| 8mzNj | 138 | 9,75112 |
| 8nmi5 | 129 | 9,77110 |
| 8nn1c | 144 | 10,10047 |
| 8rWLh | 139 | 9,69348 |
| 8rgbj | 182 | 9,65648 |
| 8rtJg | 138 | 9,69477 |
| 8sFSo | 138 | 9,65712 |
| 8sc5o | 140 | 9,81281 |
| 8srF3 | 138 | 9,65712 |
| 8sstv | 140 | 9,72552 |
| 8vLEo | 167 | 9,70954 |
| 8vTnu | 180 | 9,51129 |
| Ax8g | 130 | 10,02524 |
| C7LI | 129 | 9,72398 |
| CeHZ | 128 | 9,79038 |
| Cfo4 | 128 | 9,66653 |
| CgM2 | 139 | 9,65661 |
| GQrs | 133 | 9,57151 |
| IWLV | 135 | 9,95084 |
| RLy2 | 138 | 8,88789 |
| RNJw | 138 | 8,41449 |
| RWBH | 134 | 9,49079 |
| RXHy | 138 | 9,51897 |
| Sgjl | 128 | 9,69735 |
| UffJ | 134 | 9,69787 |
| ZPS0 | 138 | 8,86900 |
| fWaO | 135 | 11,17206 |
| hUqQ | 138 | 9,93543 |
| x92m | 132 | 9,84885 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_294
6K8ux
|
4 | 37,5% | 133 | 2.108E-37 |
| 2 |
phalp2_8525
1q2M8
|
1 | 33,8% | 130 | 4.882E-29 |
| 3 |
phalp2_14047
7ZnfK
|
1 | 28,6% | 143 | 5.555E-27 |
| 4 |
phalp2_33437
75ODu
|
11 | 34,3% | 134 | 3.811E-23 |
| 5 |
phalp2_28604
89LNO
|
4 | 29,7% | 138 | 1.844E-22 |
| 6 |
phalp2_15584
15HTr
|
10 | 25,7% | 136 | 5.372E-20 |
| 7 |
phalp2_12596
1o9Iy
|
9 | 26,5% | 98 | 6.680E-19 |
| 8 |
phalp2_3148
8dGzQ
|
4 | 26,7% | 116 | 9.154E-19 |
| 9 |
phalp2_1660
8hB0T
|
10 | 32,7% | 107 | 3.227E-18 |
| 10 |
phalp2_13741
6Igr0
|
2 | 33,0% | 112 | 5.487E-17 |
Domains
Domains
1
131 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(hWzW)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50