Protein

Protein accession
2mBH0 [EnVhog]
Representative
6crLy
Source
EnVhog (cluster: phalp2_33303)
Protein name
2mBH0
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MRDITLCHPRLQALAAELIRKCADQGLQIKIGETLRTTAEQDALYAQGRTKPGKIVTNAKGSSYSSYHQWGVAFDIYRADGCGAYYDKDGFFSKVGAIGVSIGLEWGGNWKSLTDRPHFQLPDWGSSTSGIKKIYKTPEQFMKTWPKEERKTITPGWQHDAHGWWWQNEDGSWVASDWRLINHHHYLFGASGYVRTGWHRWNPDTKQVDPADGSGDWYYLQEDGELQGACWHSRSNGAMEVWHVDK
Physico‐chemical
properties
protein length:246 AA
molecular weight:28093,9 Da
isoelectric point:6,83
hydropathy:-0,76
Representative Protein Details
Accession
6crLy
Protein name
6crLy
Sequence length
312 AA
Molecular weight
35896,41790 Da
Isoelectric point
8,73445
Sequence
MMDNYYLLAYRHYIICRNSFQYTKNAKFDHVKHCMVFFHIIIKKGDKPMRDITLCHPRLQKIAAAWIKACAVEGITVAISETLRTAAEQDALYAQGRTKPGNIVTNAKGSSYKSQHQWGIAFDFYLKMDVDGDGKISDDAYNDSKGHFKRAAEIGKKLGLAWGGDWSSIVDKPHLYLPDWGSTPTPLIQQFKTPEQFMKTWVPEQVKTGWQQENGGWRFYLKYGSGKYVSNDWYKDGDKWYWFDGAGMMVHDTWYQYKGSWYYLGSDGAMLKGLQTISGKWYYLDQTGRMATEPVVLTPDQDGALHYLGLEK
Other Proteins in cluster: phalp2_33303
Total (incl. this protein): 183 Avg length: 257,8 Avg pI: 6,63

Protein ID Length (AA) pI
6crLy 312 8,73445
13xZj 246 6,40669
1c13e 266 6,43192
1dM3I 217 6,31881
1dM6D 251 5,48976
1dMds 247 5,81022
1m2rg 264 6,10618
1mrDW 247 5,54649
1oiqg 264 5,56092
2dgDp 272 8,47451
2dhZ0 272 7,58325
2dhZf 247 5,53881
2l3Sz 272 8,19034
2m5Fd 202 9,37978
2mC5B 264 6,59198
2my9F 264 6,15648
3bVoS 259 5,26940
3jUMU 246 5,77742
3k0Ls 272 5,86996
3kVKe 246 6,82690
3kVoV 246 5,78208
3kzrg 272 6,82741
3l17E 286 7,63037
3lH6A 289 6,58840
3lSXr 289 6,30796
3lcgv 289 6,99491
3msFD 202 9,50021
3oPQb 252 4,94416
3oVQs 247 6,65132
3ob1x 288 5,42764
3opby 252 4,95695
3p0a6 246 6,37628
3pFVP 289 7,65197
3pFm2 292 6,38111
3pJaT 294 7,04073
3pM1R 280 8,67037
3q7SE 247 5,62288
3qAuu 234 6,30347
3qeKC 264 5,86649
3qmTM 246 6,34161
3qpTy 246 5,78350
3qvNo 280 8,46749
3r5zU 292 6,99969
3rUNk 242 5,99023
3rYuT 282 8,50965
3s4lp 246 6,54895
3sJzX 239 7,70415
3sbdZ 294 7,62833
3ssKi 280 8,27305
3suVq 289 7,03703
3swEU 282 8,15359
3swnO 246 5,61668
3sxBo 264 7,00571
3szlK 272 8,75637
3t5PH 246 5,69967
3uFqE 280 8,46078
3wAmx 247 6,99673
3wIpj 264 6,59130
3xHLT 248 6,07065
3xLYv 264 6,52247
3xpLi 280 8,67823
3ybxl 264 8,27054
4tg52 282 8,46755
5K6JA 261 5,59514
5KByv 294 7,62833
5KEEi 266 8,57760
5KPnk 261 5,59747
5LuW4 280 8,21374
5MARO 243 9,05724
5OhiF 272 6,23253
5PPg2 292 7,63123
5Q2Ws 239 6,44716
5QZsI 264 5,87501
5RDSL 271 8,73200
5RW8H 294 7,64038
5SyF9 248 5,77742
5UnMb 245 6,79262
5VfHf 286 8,60119
5Vxlz 286 8,11085
5Wcwa 286 8,11562
5X9qV 246 6,19377
5XANs 264 5,74502
5YHs4 308 7,04294
5YOKv 286 8,11562
5YOZJ 248 5,95658
5YlzJ 264 6,59391
5Z9WF 242 7,60860
5ZAMK 238 6,13079
5ZKFt 238 6,70572
5ZMZW 238 8,30606
5ZcZe 238 6,44352
606yi 285 7,00827
60bTO 264 6,21514
61dQi 261 5,79720
62aLH 286 8,60119
63CEW 264 5,68108
63x6Y 239 6,70833
64bP4 246 5,81977
65HTv 286 8,74850
65SQP 261 5,89252
65y8V 261 5,96658
66Uu5 261 5,74332
67MPp 247 5,50670
67YVs 202 9,50040
68IAs 243 6,44960
6S8Tp 249 5,77413
6Swwn 233 6,23907
6aJOn 261 5,73587
6acfv 239 6,44977
6cymw 239 6,70833
6dWDd 202 9,35973
6f2eJ 266 8,30412
6fFqt 208 6,90829
6fa4B 248 6,15012
6goAJ 261 6,23674
6h0IT 238 6,24202
6iHXy 270 7,62026
6iMBh 242 6,59198
6kDb8 263 6,30233
6l5Ez 299 8,76823
6lWDn 286 8,40734
6n0DG 268 5,65425
6nMSp 272 8,17300
6nOsw 246 7,75354
6pP9u 261 5,97295
6qgLn 239 7,69716
6qkbh 261 6,05491
6r8tR 239 6,26283
6rGFM 246 6,05957
6rkoj 256 6,89982
6sC7M 238 7,84337
6so7l 261 6,05571
6t636 248 5,95658
6toDn 248 5,46742
6uotH 261 6,15716
6vUYW 246 6,54537
6w5Aq 266 8,30412
70fsJ 247 5,49488
72AIk 261 5,42809
79Foz 252 4,78416
7XYve 264 7,64436
7YC9o 248 5,78350
7YLCS 246 5,61043
7ZJpw 248 5,46947
7ZjW1 246 6,13318
7cxLt 252 4,94416
7dUsZ 247 6,16580
7hB4l 259 6,43346
7m8vq 259 7,63481
7mJvE 246 5,95993
7r4aW 247 6,95007
7vVkS 261 5,99926
80Oq0 246 5,78663
84lyh 247 6,38276
8520q 246 5,78208
86QgF 246 6,24771
86znZ 264 5,97067
87ahI 246 5,47504
89u1G 264 5,97067
8dbI0 268 5,65954
8dcYT 246 5,95993
8f6p0 248 5,96306
8hN6p 259 6,95979
8jSPR 246 5,95993
8kcfU 248 5,63294
8lX45 246 5,81886
8lpWF 247 6,38173
8oOXe 261 5,63930
8olXe 246 5,78663
8omAg 246 5,33789
8opRH 252 5,02669
8ouGE 252 4,94416
8ovvo 252 4,94416
8qlAM 268 5,52261
8qn2q 246 5,30503
8r4qy 246 5,33340
8sUoP 246 5,56877
8tJ1W 246 5,78208
8tbKf 264 5,54973
8teze 246 5,60855
8vtfL 247 5,53881
Oxre 243 5,57695
Similar Clusters

No similar clusters were found for representative 6crLy.

Domains

Domains
Representative sequence (used for alignment): 6crLy (312 AA)
Member sequence: 2mBH0 (246 AA)
1 312 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF13539, PF19127

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (6crLy) rather than this protein.
PDB ID
6crLy
Method AlphaFoldv2
Resolution 82.39
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50