Protein
- Protein accession
- 2lwDW [EnVhog]
- Representative
- 1gOqM
- Source
- EnVhog (cluster: phalp2_17998)
- Protein name
- 2lwDW
- Lysin probability
- 94%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MRKKVLIGLLAVTMLTACAKEESEIVPIEPEVPETPIIYVEPIVEEQPPYFELSEYERWVVECIVMGEAGGEPWDGQRLVAQCILNACLRDGIQPSEVRSKYKYAGWNDSPSEEVRSAVSAVFDDGNVVIDEPILWFYAPARCESKWHETQVHIITVGGHKFFKEHTHDWW
- Physico‐chemical
properties -
protein length: 171 AA molecular weight: 19561,0 Da isoelectric point: 4,70 hydropathy: -0,21
Representative Protein Details
- Accession
- 1gOqM
- Protein name
- 1gOqM
- Sequence length
- 168 AA
- Molecular weight
- 18970,27130 Da
- Isoelectric point
- 4,68628
- Sequence
-
MKRPIQSLAIVSAILLCFILFASPASEAEVYTETEMVMPTDAEPEIVEPYYPLTEDERDLVERVVAAEARGEKIETQMAVAQTILNRAETRGQTVTEVCTAAYQFAKPYQGEVSEKTQDAVRFVFDDGAKVFDKVTHFYAHKLIDPPYWTESKEFKGEIGGVRFYADK
Other Proteins in cluster: phalp2_17998
| Total (incl. this protein): 126 | Avg length: 203,7 | Avg pI: 5,21 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 1gOqM | 168 | 4,68628 |
| 135w7 | 241 | 6,67076 |
| 13HKp | 203 | 4,66611 |
| 13sFh | 187 | 4,53737 |
| 13zBy | 179 | 4,67827 |
| 13zRT | 202 | 4,68447 |
| 14vFz | 187 | 4,70641 |
| 1FYmx | 187 | 5,14782 |
| 1acxY | 212 | 4,72465 |
| 1dRof | 182 | 4,90455 |
| 1fCGq | 184 | 4,85373 |
| 1gDxm | 181 | 4,69680 |
| 1m6os | 166 | 4,39783 |
| 1mbKu | 205 | 5,02749 |
| 1mii7 | 189 | 4,18650 |
| 1nnzV | 187 | 4,38424 |
| 23MCb | 196 | 4,35616 |
| 23Rgo | 198 | 4,79468 |
| 23fe7 | 232 | 5,36255 |
| 2H9qU | 238 | 6,04536 |
| 2Js6k | 237 | 6,37435 |
| 2VntB | 234 | 5,37387 |
| 2bXhd | 203 | 5,47157 |
| 2bZld | 179 | 4,78751 |
| 2lvPQ | 263 | 6,17626 |
| 2lvRV | 186 | 5,31248 |
| 2ofrV | 193 | 5,16618 |
| 3OPJ3 | 198 | 4,46291 |
| 3PzHO | 205 | 4,89329 |
| 3Q0XT | 188 | 4,53015 |
| 3ZTBA | 224 | 4,38811 |
| 3caMb | 193 | 5,69995 |
| 3dRwU | 198 | 4,80746 |
| 3dTDs | 181 | 4,53106 |
| 3dZsB | 177 | 4,70095 |
| 3eSll | 195 | 4,48610 |
| 3esGW | 246 | 6,03661 |
| 3nQIN | 206 | 5,21881 |
| 3nRnz | 242 | 5,64220 |
| 3qRFZ | 253 | 5,57712 |
| 3rgQ | 184 | 5,00441 |
| 3tiMz | 253 | 5,71234 |
| 3tzBP | 253 | 7,60201 |
| 3viRp | 176 | 4,99373 |
| 3vyRd | 253 | 8,16558 |
| 3w0WQ | 253 | 5,48220 |
| 3wpwP | 253 | 7,58411 |
| 45mVC | 184 | 5,09535 |
| 4G0G4 | 192 | 5,36670 |
| 4HpxE | 193 | 5,34141 |
| 4HrV9 | 201 | 5,22392 |
| 4SCxh | 200 | 6,44750 |
| 4Uh5R | 185 | 4,70754 |
| 4xCiO | 198 | 4,75404 |
| 4xDHM | 242 | 5,93379 |
| 4xtek | 178 | 4,36503 |
| 5C9l | 186 | 4,60591 |
| 5CDV | 182 | 5,11650 |
| 5Kl6J | 153 | 4,47013 |
| 5L3GA | 197 | 4,30626 |
| 5MO97 | 253 | 5,59059 |
| 5N07P | 143 | 4,65053 |
| 5Vn67 | 177 | 4,74125 |
| 5Wx3r | 188 | 6,18911 |
| 5XSmb | 200 | 4,70788 |
| 5XsfC | 253 | 5,85586 |
| 5e25O | 255 | 9,09638 |
| 5xL1 | 197 | 4,49138 |
| 5zV8 | 211 | 4,48650 |
| 67PG5 | 220 | 8,56232 |
| 67Vjj | 188 | 5,55211 |
| 6aXe2 | 177 | 4,74125 |
| 6aaiA | 174 | 4,69623 |
| 6adV1 | 212 | 4,56482 |
| 6ag2t | 188 | 5,81909 |
| 6doQm | 180 | 4,35355 |
| 6doi7 | 187 | 4,69293 |
| 6fiYM | 253 | 5,91708 |
| 6g6f7 | 253 | 5,71234 |
| 6gle8 | 187 | 4,46626 |
| 6iQQc | 174 | 4,77348 |
| 6kde7 | 178 | 4,70049 |
| 6klIK | 235 | 5,59724 |
| 6lOdy | 187 | 4,43147 |
| 6mrns | 253 | 5,48220 |
| 6n4NJ | 196 | 4,61325 |
| 6n6x8 | 174 | 4,69623 |
| 6nTLv | 200 | 4,70788 |
| 6nVt | 202 | 4,90312 |
| 6nqHj | 253 | 5,58082 |
| 6oEaY | 187 | 4,59870 |
| 6pBnh | 217 | 7,78838 |
| 6pfE1 | 143 | 4,73090 |
| 6r3mW | 253 | 6,02035 |
| 6sdAt | 189 | 5,03317 |
| 6tN7a | 188 | 4,84327 |
| 6tUVw | 187 | 4,44262 |
| 6tYRJ | 174 | 4,77348 |
| 6uw2Q | 212 | 4,51929 |
| 6vnoL | 177 | 4,74096 |
| 6xTV | 192 | 4,75489 |
| 71h1r | 229 | 6,21287 |
| 7DKqU | 205 | 5,77458 |
| 7YqW3 | 211 | 4,85618 |
| 7YrWX | 201 | 5,16606 |
| 7sdNf | 196 | 4,51616 |
| 7vHLM | 194 | 4,82713 |
| 81AzE | 174 | 4,69629 |
| 85b5M | 188 | 5,49328 |
| 86WNJ | 181 | 4,61927 |
| 87trB | 187 | 4,38407 |
| 8bGTH | 201 | 4,33462 |
| 8ic4u | 174 | 4,77348 |
| 8kHdI | 246 | 6,51701 |
| 8lStC | 200 | 4,83657 |
| 8mJS2 | 253 | 5,57712 |
| 8n4QT | 204 | 4,55726 |
| 8ovYd | 259 | 8,90349 |
| 8qZbq | 200 | 4,70788 |
| 8qaPx | 253 | 5,61674 |
| 8qnpD | 190 | 5,42883 |
| 8qo8T | 176 | 4,54726 |
| 8rh0O | 165 | 4,64172 |
| 8vSQF | 253 | 5,47589 |
| oo90 | 242 | 5,76219 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_3183
8lAFw
|
153 | 40,8% | 125 | 4.514E-48 |
| 2 |
phalp2_17220
3xQdv
|
9 | 35,0% | 154 | 7.893E-44 |
| 3 |
phalp2_11404
b5ye
|
2 | 38,8% | 175 | 1.245E-38 |
| 4 |
phalp2_24037
80uQf
|
46 | 37,9% | 124 | 3.202E-38 |
| 5 |
phalp2_9772
884Pu
|
12 | 35,0% | 134 | 2.626E-36 |
| 6 |
phalp2_39551
5KJlt
|
3 | 36,0% | 150 | 9.248E-36 |
| 7 |
phalp2_19123
1FKpE
|
5 | 48,6% | 115 | 2.664E-33 |
| 8 |
phalp2_20006
1jC1n
|
4 | 31,3% | 118 | 1.160E-31 |
| 9 |
phalp2_19245
7WEKe
|
72 | 34,4% | 145 | 1.961E-24 |
| 10 |
phalp2_29561
40ZMT
|
29 | 27,8% | 140 | 1.412E-21 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(1gOqM)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50