Protein
- Protein accession
- 2agWD [EnVhog]
- Representative
- 4igQU
- Source
- EnVhog (cluster: phalp2_3494)
- Protein name
- 2agWD
- Lysin probability
- 69%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MIVLSAGHNPDAPGACHAGFCEHSEAVRWVELIATQLAAANVPHRVLPTGHLAKKVSTINHWHHTDGVRLALEVHFNSATYAGRGCETLYCPGSINGLRAAEHIQSAIASVMQPDRGVHEGWYLMDKPGQEDYPGDKDGDEKPLYFLAKTRPVAVIIEPEFIQRYHIISERRMACCAAISQALADIAAGRV
- Physico‐chemical
properties -
protein length: 191 AA molecular weight: 20839,5 Da isoelectric point: 6,29 hydropathy: -0,14
Representative Protein Details
- Accession
- 4igQU
- Protein name
- 4igQU
- Sequence length
- 177 AA
- Molecular weight
- 19522,99040 Da
- Isoelectric point
- 5,87627
- Sequence
-
MIFISAGHYERKQGASFGNFTEWKEATSWQSIIMGLLGPAAIAVPPISLRSKVIFINNHKPDSGDIAVEIHFNSAVNSHGNHIGEGSETLYCPGSSKGKIIAEHVQGSMCRIWPPSRGVKEGWYQMNPDKGPDYFLKATHCPAIIVEPEFVHNEDMIEERRYVGCAALAEALLDLQT
Other Proteins in cluster: phalp2_3494
| Total (incl. this protein): 146 | Avg length: 184,6 | Avg pI: 6,99 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 4igQU | 177 | 5,87627 |
| 106b5 | 173 | 6,69986 |
| 14jAj | 183 | 6,07014 |
| 16VNX | 196 | 5,81681 |
| 16Wf4 | 170 | 5,95766 |
| 18RKd | 201 | 8,28620 |
| 18Rza | 193 | 6,05957 |
| 1aplT | 194 | 5,88434 |
| 1bb9U | 178 | 7,05698 |
| 1dCLq | 178 | 7,05624 |
| 1hHCv | 192 | 5,14054 |
| 1hLHW | 192 | 5,49573 |
| 1i9L1 | 183 | 5,62345 |
| 1iQjA | 191 | 6,42215 |
| 1j6g9 | 205 | 7,66021 |
| 1j6jJ | 165 | 4,92035 |
| 1oPy8 | 202 | 5,51841 |
| 1oyU5 | 184 | 6,06327 |
| 25cfW | 193 | 7,68545 |
| 2D5le | 191 | 6,54020 |
| 2DhWg | 180 | 7,10103 |
| 2IJkx | 189 | 6,23861 |
| 2R1EJ | 190 | 6,05644 |
| 2TCVV | 187 | 6,08134 |
| 2V8Z4 | 174 | 8,80395 |
| 2V9c8 | 175 | 6,38179 |
| 2abfG | 200 | 5,46293 |
| 2dNqz | 181 | 5,86751 |
| 2jY7E | 173 | 5,95408 |
| 2jsHy | 207 | 5,76537 |
| 2lMut | 176 | 5,09928 |
| 2lOqj | 196 | 5,29503 |
| 2ltIL | 205 | 4,93621 |
| 2ltxn | 201 | 5,32879 |
| 2m6iX | 196 | 5,28724 |
| 2rG3m | 176 | 5,39950 |
| 2rGzV | 187 | 4,66031 |
| 2rRjK | 174 | 4,72692 |
| 2sFey | 188 | 7,72183 |
| 33nIH | 170 | 9,71753 |
| 343oZ | 170 | 9,54882 |
| 38xtN | 225 | 6,12505 |
| 3HBG | 191 | 4,89261 |
| 3QwGb | 212 | 5,66175 |
| 3bt3U | 188 | 7,73035 |
| 3grqI | 192 | 8,80704 |
| 3yTxb | 231 | 6,24936 |
| 41Fap | 169 | 9,15898 |
| 43MpK | 179 | 8,45801 |
| 44Y8f | 189 | 6,08219 |
| 44aZ | 176 | 6,04746 |
| 47OUc | 198 | 6,59335 |
| 47PtJ | 191 | 7,72728 |
| 47SQn | 192 | 6,65490 |
| 48m56 | 178 | 8,76984 |
| 4BDjw | 183 | 6,09254 |
| 4BUaU | 180 | 9,12197 |
| 4BXBy | 180 | 9,50588 |
| 4BYyv | 179 | 9,24169 |
| 4C0Eu | 180 | 9,40292 |
| 4C1c6 | 168 | 9,27334 |
| 4C4vQ | 172 | 8,88950 |
| 4K9Fm | 145 | 6,18308 |
| 4Nagm | 196 | 6,11789 |
| 4NbSY | 191 | 7,68068 |
| 4NgQS | 192 | 5,78117 |
| 4Ngb5 | 187 | 6,19814 |
| 4Okjs | 178 | 6,69878 |
| 4QlQC | 191 | 5,34385 |
| 4Qlxw | 190 | 6,08583 |
| 4QrMM | 202 | 6,64865 |
| 4e0qt | 174 | 8,22393 |
| 4hC37 | 182 | 5,73826 |
| 4hFvY | 188 | 5,85074 |
| 4hJtQ | 178 | 5,52034 |
| 4hK6k | 216 | 5,42195 |
| 4hKsE | 177 | 5,28747 |
| 4hNcO | 187 | 4,90170 |
| 4hq01 | 179 | 5,51630 |
| 4hrC3 | 185 | 4,96059 |
| 4hwC8 | 191 | 5,63760 |
| 4iFwG | 188 | 5,59832 |
| 4iL8j | 189 | 6,14841 |
| 4iXLM | 192 | 5,26104 |
| 4iYXH | 193 | 4,89824 |
| 4iZMu | 177 | 4,71311 |
| 4iZiA | 198 | 5,21068 |
| 4ianV | 196 | 5,76429 |
| 4ijUP | 188 | 4,77433 |
| 4j15A | 190 | 5,41814 |
| 4jA72 | 178 | 6,05559 |
| 4jGYs | 191 | 5,39961 |
| 4jGba | 176 | 5,57167 |
| 4kAcS | 144 | 5,94191 |
| 4kzbL | 167 | 6,07208 |
| 4lL3R | 170 | 9,90417 |
| 4mCBl | 180 | 9,36360 |
| 4nGAi | 171 | 9,79721 |
| 4oXcP | 180 | 9,40395 |
| 4peOl | 168 | 9,58402 |
| 4rH4S | 180 | 9,54862 |
| 4rVqG | 168 | 9,50556 |
| 4s2Xk | 180 | 9,40292 |
| 50YwC | 170 | 8,92889 |
| 51bOu | 180 | 9,29803 |
| 58eB0 | 180 | 9,36366 |
| 5B93T | 213 | 5,80698 |
| 5Hgn5 | 186 | 8,88531 |
| 5d5g5 | 170 | 8,95693 |
| 5dMQQ | 180 | 5,97113 |
| 5grgf | 162 | 8,67907 |
| 5hLu2 | 170 | 9,90010 |
| 5ib0K | 170 | 8,94539 |
| 5ij6U | 180 | 9,12474 |
| 5oiDm | 180 | 9,32956 |
| 5qTlI | 200 | 6,12994 |
| 5uX4b | 170 | 9,55926 |
| 5veT7 | 170 | 9,36456 |
| 5vgSR | 170 | 9,92434 |
| 5w3xo | 171 | 9,87090 |
| 5wC2n | 170 | 9,56184 |
| 5zsSg | 180 | 9,54811 |
| 6LYns | 180 | 9,36366 |
| 6Q6FL | 170 | 7,83750 |
| 77WNx | 194 | 6,02609 |
| 7IxSJ | 190 | 7,72166 |
| 7kPJ4 | 191 | 5,28645 |
| 8e6cL | 190 | 6,24111 |
| A5Zp | 199 | 4,64820 |
| Jo8q | 170 | 9,90642 |
| LETJ | 168 | 9,41285 |
| QGgj | 180 | 6,12266 |
| Qr2l | 185 | 7,07903 |
| TkIa | 170 | 9,25162 |
| UMoA | 205 | 6,21952 |
| VQYU | 237 | 5,43633 |
| VRO5 | 204 | 5,81283 |
| XMml | 185 | 5,26314 |
| XNMH | 192 | 7,75286 |
| Yg9h | 182 | 6,15529 |
| cbxq | 198 | 8,89814 |
| f0PK | 179 | 7,05397 |
| l37C | 183 | 5,57508 |
| otrL | 180 | 5,96459 |
| uHgI | 180 | 9,14988 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_32886
3hE4J
|
1 | 42,2% | 187 | 6.413E-64 |
| 2 |
phalp2_29375
16Xou
|
2 | 32,7% | 180 | 1.246E-47 |
| 3 |
phalp2_39240
3QaAt
|
19 | 32,2% | 177 | 1.061E-39 |
| 4 |
phalp2_1736
2tF5N
|
2 | 31,6% | 161 | 5.170E-27 |
| 5 |
phalp2_38396
Ydyo
|
10 | 35,6% | 160 | 1.623E-25 |
| 6 |
phalp2_21852
4t88M
|
271 | 29,8% | 181 | 1.776E-23 |
| 7 |
phalp2_6374
7yZe6
|
41 | 27,6% | 181 | 4.050E-22 |
| 8 |
phalp2_1943
4rYA7
|
14 | 27,9% | 168 | 7.566E-22 |
| 9 |
phalp2_36343
kBxJ
|
714 | 29,0% | 196 | 1.034E-21 |
| 10 |
phalp2_21590
2ns10
|
22 | 28,8% | 187 | 6.735E-21 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(4igQU)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50