Protein

Protein accession
2ZiZS [EnVhog]
Representative
B9iS
Source
EnVhog (cluster: phalp2_15195)
Protein name
2ZiZS
Lysin probability
97%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MTSSKKPYAPAKTPATGKRAGTEKFSDLCRRRTSWSFTNLGTWVVRDIRNKPGQMSQHAAGLALDLQYSNRAMCLEALDWIIANSDELGVSLANDYMAGKYGRTWICDRAAWKVHTTDTIGIRGSWIHIELHRLFADNPTLVETNWRKIPRP
Physico‐chemical
properties
protein length:152 AA
molecular weight:17220,5 Da
isoelectric point:9,71
hydropathy:-0,50
Representative Protein Details
Accession
B9iS
Protein name
B9iS
Sequence length
105 AA
Molecular weight
11613,01460 Da
Isoelectric point
9,62676
Sequence
MNYTGTTDGAALGKRPGTEKFVDIIKKKGFTNLGTWAVRNMRGSDRLSVHATARAADIGYKDKATAAMWANWLVANYETLGIEEVHDYAGTTKKGTEKWGRGWRC
Other Proteins in cluster: phalp2_15195
Total (incl. this protein): 156 Avg length: 129,6 Avg pI: 9,57

Protein ID Length (AA) pI
B9iS 105 9,62676
15f43 152 9,78877
15iCv 107 8,80279
166dN 152 9,78877
18C64 155 9,39125
19Ia4 152 9,61986
1JCNZ 149 9,56764
1Kemz 98 9,26412
1LeVf 152 9,71179
1LspO 149 9,36669
1WG1C 108 9,14466
1ZEQd 155 9,90268
1gNG3 83 10,22992
1iFYB 124 8,75985
1iGmH 129 9,37836
1o9EL 150 9,91596
1pVfO 152 10,21606
1pyH7 152 10,21606
1y92X 115 9,42555
1yCOH 152 9,67118
1ygwm 62 9,56558
1zCMN 149 10,00042
210Fs 100 8,70228
22L4t 110 9,45856
2GBqP 149 9,81926
2GCER 155 9,21100
2QiR9 149 9,81926
2YfCm 99 8,92850
2j6kT 152 9,71244
2jd1C 155 8,49295
30phR 86 9,35934
32QKp 99 9,39390
3TvPR 157 9,62424
3Utvv 172 10,03433
3WgqT 157 9,95239
3jzEf 155 9,59536
41S1f 152 9,95542
46WZp 156 9,51445
49dyT 149 9,78425
4AcPI 125 9,87773
4ClVt 88 9,91209
4DNZK 154 10,34835
4IW5I 98 8,78989
4NQGW 149 9,89927
4NuHz 93 9,59356
4aXBE 152 9,74822
4jls9 121 9,40853
4lfEC 156 9,90326
4lpVx 88 9,39113
4mBEf 98 8,97466
4mIUl 155 9,69400
4mzDu 156 9,73932
4nCVI 155 9,75389
4oJhp 161 9,69355
4oQWh 151 10,15450
4oWED 149 9,83892
4odCs 165 10,36608
4ofc7 137 9,57306
4og0A 121 9,87451
4pa5P 84 9,46623
4q0TA 162 9,44728
50E7g 71 9,82841
50VYz 84 10,53363
50cU7 83 9,26167
50cdP 129 9,54972
514QX 152 9,96844
51Zuz 122 9,07562
52Sg7 152 10,01518
52xrc 92 9,51329
53pkm 56 9,38990
553di 86 9,92847
55wqz 90 9,91203
56nzs 109 9,74951
56qSc 93 9,37198
58sGa 103 9,51400
59ITL 155 9,69400
5BI4o 146 9,67176
5Bvu3 149 9,14382
5BwbC 103 6,55157
5Bx1w 98 11,52013
5CuJE 156 9,54437
5DNiu 68 9,56480
5HBCC 153 9,87270
5HBz8 110 9,26109
5avQi 149 9,61090
5bEFi 99 8,68597
5eHA1 104 9,35754
5eIwf 152 10,01344
5eSxG 112 9,07355
5f0Gd 168 9,27740
5f0e7 149 9,51271
5f2VS 89 9,10237
5ixha 81 10,00048
5j60T 149 9,51587
5kNv0 83 9,84079
5mHO3 149 9,63553
5msyh 151 9,39222
5nwjO 118 9,35715
5nzLR 102 9,32769
5tldu 168 9,18425
5ulJ5 98 9,37391
5vxiG 99 9,34020
5wBOM 98 8,80762
5xJF4 88 10,00448
5zYZF 98 9,64371
5zeoa 149 9,61096
5ziQ9 152 9,90333
5zjfE 106 9,51645
5zwmP 164 9,27766
6A73L 129 9,54972
6A7Vr 149 9,51175
6ABfW 114 9,39048
6Axsp 86 9,86542
6IEj4 98 9,63978
6K8Zp 162 8,99194
6MADA 83 10,00177
6MLgP 164 9,15221
6MeBn 148 9,61090
6Usqe 157 9,99590
6xWXP 80 10,07842
6xf6H 85 9,51877
6xqcT 168 9,23318
6xw19 149 9,51175
6xyTj 149 9,64913
6yNJL 149 9,61154
6yb7o 149 9,89927
6ygH3 91 9,37237
6zRV4 140 9,77626
6zmDN 166 9,29932
7VxS5 161 10,10434
807DE 150 9,79889
83F0J 152 9,67118
84FUj 156 9,11971
892Aw 153 9,78948
8Qhp 86 9,36785
8mr1G 173 9,05447
8ojcC 164 10,14657
8sGay 152 9,81513
Basp 157 9,46159
C8ha 156 9,09999
C8xF 152 9,71244
DkhA 159 9,87419
GovV 187 9,61180
JbVZ 152 9,34323
KXIn 159 9,15221
Lw44 149 9,51516
TKlJ 152 9,57976
amDl 50 8,73787
jVmZ 152 9,75705
owe 149 9,87180
sUJk 109 9,37307
t2dv 76 9,51291
x7qE 102 9,20526
xaui 94 9,91648
xdC7 139 9,39016
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_27264
46ZD7
137 53,2% 122 3.873E-43
2 phalp2_36358
qD4l
947 49,5% 107 3.126E-37
3 phalp2_4433
2R1uw
426 46,3% 110 1.392E-35
4 phalp2_1708
2iIeV
1834 37,8% 119 8.220E-30
5 phalp2_1503
1ZCI1
63 37,6% 101 1.449E-21
6 phalp2_25213
277Y6
1 45,5% 79 3.953E-18
7 phalp2_27650
6yOm4
19 45,3% 64 4.970E-17
8 phalp2_24209
2JSVL
35 31,9% 97 6.819E-17

Domains

Domains
Unannotated
Representative sequence (used for alignment): B9iS (105 AA)
Member sequence: 2ZiZS (152 AA)
1 105 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (B9iS) rather than this protein.
PDB ID
B9iS
Method AlphaFoldv2
Resolution 96.38
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50