Protein

Protein accession
2Ygu2 [EnVhog]
Representative
5HKSo
Source
EnVhog (cluster: phalp2_5892)
Protein name
2Ygu2
Lysin probability
92%
PhaLP type
VAL
Probability: 92% (predicted by ML model)
Protein sequence
MTDERDLDPSRWQGVPWLRGGRDPRVGLDCWGLVLLCLPGVPDYAGDAVERAALARATAAGWEDPRWRPLAEPRDLCLAMLDRTHAGVVWRGHVVHATECGVRIDPLRDLPGIGYRAARFLEWRPDGKAVSR
Physico‐chemical
properties
protein length:132 AA
molecular weight:14745,7 Da
isoelectric point:6,82
hydropathy:-0,34
Representative Protein Details
Accession
5HKSo
Protein name
5HKSo
Sequence length
130 AA
Molecular weight
15083,25050 Da
Isoelectric point
5,93555
Sequence
MLNKIEELVGIPFVDGGRTPEEGFDCWGLVKWIYHMRGIELPNYPIPADNRDAVNAKMIKELVKWEKIEQPKEGDMVLLELAEGVPNHVGICLRDRNFIHAYGKSVVIDRLRRWNSRVVGFYRPTEESYV
Other Proteins in cluster: phalp2_5892
Total (incl. this protein): 183 Avg length: 129,8 Avg pI: 7,21

Protein ID Length (AA) pI
5HKSo 130 5,93555
10I3H 106 8,60719
10XX4 140 6,28789
14IbK 116 6,18075
14YEU 136 5,40035
150D2 130 8,41520
151Vv 112 7,66834
152XG 104 7,87773
152sL 130 8,77449
15uYe 116 6,40271
16Zva 101 7,94652
171hl 148 5,48163
171w1 130 9,13557
172BR 147 9,33111
175m1 130 9,05357
17Ou 145 6,27738
19YEW 133 6,57936
1CU2h 115 7,70165
1FXvc 114 6,26334
1HIiy 132 5,64874
1HIqB 132 5,13213
1LZfc 132 8,37233
1cNmA 138 5,76668
1fajA 139 9,51381
1iMqQ 118 8,54388
1j4ns 110 6,81678
1kAMw 150 6,57595
1lHCp 132 4,95428
1lKAH 111 6,26828
1mCzp 142 6,89061
1mEWz 132 8,54163
1mFFl 134 5,90372
1p0Lt 115 6,72533
21mc4 146 8,51964
26O8w 125 8,81413
2AmEV 161 9,80114
2CVI7 161 7,96006
2LSS9 135 7,73274
2LoML 85 9,44135
2MjBw 125 9,15272
2NLiE 112 6,81564
2PUVu 130 9,19385
2Qifc 141 6,71282
2SweX 148 8,99310
2UjQk 129 7,76343
2aCFI 126 7,06272
2aYNB 129 6,58289
2aZYj 103 8,56690
2agWo 125 6,16739
2asMc 126 5,73763
2cja6 154 10,03871
2cyFI 127 5,09132
2edX9 135 7,69045
2ehUl 135 6,89766
2jBPe 116 6,95257
2kYUJ 135 6,57641
2tBOC 115 6,71924
2wnX8 134 6,88169
2xnfi 134 7,63236
2zJhr 115 5,73030
34SO2 115 4,95797
37S0i 145 8,51745
37T65 143 5,52773
3HRGF 134 6,39799
3NH0G 140 7,24233
3PhLU 140 7,75985
3Q75M 164 7,92383
3XDE 134 7,00253
3amEj 115 6,09936
3amlk 115 7,70165
3bt2x 139 5,63999
3d5TO 150 6,07566
3eJXq 116 6,88857
3eKam 114 8,46272
3eKhO 112 7,72365
3eLB4 116 6,88987
3eLIm 112 7,72888
3eLPL 112 7,72365
3eLQr 114 7,72041
3eLxG 114 6,26732
3eLxe 116 5,52699
3eM0I 116 6,95035
3gcmt 146 8,13283
3gupP 136 5,64527
3iRfi 114 6,81058
3k6V4 132 5,76748
3kW07 132 4,89210
3n48L 115 6,11038
3naen 115 6,71674
3nfIn 115 7,70148
3nfwA 145 8,54001
3nhvf 80 9,62070
3nk6i 114 6,49280
3nmTI 97 7,97662
3xDKw 112 7,74490
40J3o 151 8,15759
41k1d 146 7,59456
45cze 115 6,82320
4AdKJ 134 6,81831
4B44L 159 8,92605
4B7J8 141 8,96215
4BIi2 137 7,83067
4BLUx 131 8,57573
4BuQg 137 7,12121
4Dljv 129 5,90974
4FBZ4 133 6,06719
4FCqv 154 7,12547
4H3nX 130 8,59862
4HmjO 115 5,73013
4IzB6 137 6,27283
4L0MF 150 6,05883
4MXAH 139 9,12100
4Ruzx 159 8,71788
4SQi8 148 8,27950
4Z5FC 159 6,51610
4Z7XQ 144 9,25722
4ebHu 132 8,25481
4fRGf 136 5,23535
4hPmF 135 6,32279
4i1h5 139 8,64942
4i64p 141 8,88608
4iBCQ 128 5,48396
4iGHx 103 8,58282
4ijC4 104 9,10044
4j5h7 159 9,40563
4uQiJ 159 6,51747
4uY1t 132 7,83176
4xer0 112 6,92739
4yAAq 133 6,40924
4yDJT 159 7,73797
4yDV6 144 8,96222
4yHiH 159 6,96706
4yHlN 112 6,08071
4yzTT 159 6,51928
4zaqj 159 9,13164
5EvpX 129 6,72777
5HN9O 136 5,41263
5Igem 114 6,07031
5K5x5 132 4,82759
5NeFv 132 4,97429
5UzAx 132 7,72393
5jNFs 115 6,09254
5juLS 141 9,30061
5n9d6 133 7,84698
5ucZg 112 8,43886
6331E 132 4,97429
678EQ 132 4,72385
6UJbi 130 9,19334
6k0oD 132 5,11650
6v80x 132 4,72385
7222O 132 6,95024
75Z1B 133 9,19392
7BY73 132 6,40703
7fGwb 125 6,81479
7kPu0 115 8,80608
80wi0 130 9,00167
84ozh 132 4,84748
8BnL4 144 8,28762
8bYGt 132 4,84748
8eKFc 94 6,82121
8nhGU 132 4,95428
8oA7c 132 5,11650
8rRny 132 6,40964
8y74B 134 6,39799
Al0W 138 9,17509
DvQr 132 4,80815
E1Zw 139 6,40066
HwQh 132 4,97150
K9St 132 4,88374
UPfA 103 9,03861
USLa 115 8,43738
UV69 106 8,57096
YfT5 133 7,04624
eU56 150 8,55916
eUQj 131 8,40399
fE39 143 9,01321
gxlU 112 6,08305
iKhd 115 6,93671
jrW8 148 8,99310
kybX 103 8,93237
uH9m 141 5,84353
uU31 125 8,72149
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_345
6Xoqn
767 40,0% 130 2.654E-40
2 phalp2_27198
3iRJT
385 38,7% 129 2.210E-38
3 phalp2_12585
1l6Kj
132 41,1% 124 4.156E-38
4 phalp2_27353
4yLib
52 43,5% 124 2.765E-37
5 phalp2_38609
25FGT
2035 38,7% 129 1.341E-36
6 phalp2_37361
7nTsk
49 35,9% 142 8.139E-35
7 phalp2_14093
8iNl2
704 33,0% 136 1.001E-26
8 phalp2_33663
W975
5 33,6% 122 3.222E-25
9 phalp2_13799
6XEpD
37 33,3% 126 2.139E-24
10 phalp2_19713
4Ktlf
40 35,2% 122 2.139E-24

Domains

Domains
NLPC_P60
Representative sequence (used for alignment): 5HKSo (130 AA)
Member sequence: 2Ygu2 (132 AA)
1 130 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (5HKSo) rather than this protein.
PDB ID
5HKSo
Method AlphaFoldv2
Resolution 94.27
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50