Protein
- Protein accession
- 2VcfE [EnVhog]
- Representative
- 76YNm
- Source
- EnVhog (cluster: phalp2_30701)
- Protein name
- 2VcfE
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MGKIENAVNWMISTANNNIHGYDQQYRWGEHGDYDCSSAVITAWENAGVPVKTNGATYTGNMYSVFKKCGFADVTKSVNIANGQGIKRGDVLLNRNHHTAMSIGNGQIVQASINEKGTVTGGKPGDQTGKEFYIRSYYNYPWDYVLRFNEQDNTKTKKSDQEIAKEVIAGKWGNGVTRIDNLKNAGYNPDTIQNLVNTYMSGKKTEYAIAKEVIQGKWGNGSDRIRRLRNAGYSPEYIQKLVNMMM
- Physico‐chemical
properties -
protein length: 246 AA molecular weight: 27519,5 Da isoelectric point: 9,20 hydropathy: -0,71
Representative Protein Details
- Accession
- 76YNm
- Protein name
- 76YNm
- Sequence length
- 307 AA
- Molecular weight
- 33139,61380 Da
- Isoelectric point
- 8,70235
- Sequence
-
MELFNEEVENEVTKTEKAVTWAVGIANDDSHGYDQGANRWKQDYDCSALVIQAWEQAGVPVKTAGATYTGNMKKIFLANGFADVTKSVNLTTGAGLQRGDVLLKEARHTAMSIGSGQIVQASINEKGGATGGRVGDQTGREIWTRSYYNYTGGWDCILRYTGDPATTGKTLDELAREVLAGKWGSGDARKQALTAAGYDYKAVQTRVNALLKGGTTAVKPAVTYTPGQTCTVNISLNVRTGPGTNYRKKKHSELTASGQQADSTRTGVMDPGTKVTCKEIQLDGENIWIRTPSGWLAAYYNGKQYIN
Other Proteins in cluster: phalp2_30701
| Total (incl. this protein): 80 | Avg length: 264,6 | Avg pI: 7,70 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 76YNm | 307 | 8,70235 |
| 13AJt | 224 | 9,27708 |
| 1d7qv | 258 | 8,80330 |
| 1gIlF | 239 | 9,33671 |
| 1gJAX | 292 | 9,18470 |
| 1k2Tn | 244 | 9,12423 |
| 21Akc | 239 | 4,86561 |
| 21HuO | 245 | 9,01012 |
| 239dt | 244 | 4,93103 |
| 23aCW | 244 | 9,28076 |
| 23uXn | 243 | 4,82781 |
| 24I4g | 248 | 9,42536 |
| 2VaLn | 247 | 9,36340 |
| 2VbUf | 244 | 9,31415 |
| 2Vboj | 305 | 6,10413 |
| 2Vd39 | 249 | 9,65441 |
| 2VjLs | 247 | 9,53109 |
| 2VkvX | 235 | 9,28965 |
| 2Vnrt | 249 | 9,78200 |
| 3GQ9x | 232 | 6,04815 |
| 3Jc6Q | 301 | 6,53656 |
| 3lI7r | 339 | 9,34864 |
| 3lNRu | 232 | 6,04815 |
| 40dYP | 233 | 9,09689 |
| 4ysBd | 243 | 4,61501 |
| 4yuIT | 243 | 4,65616 |
| 5HJch | 299 | 9,23099 |
| 5M51t | 301 | 6,23554 |
| 5MltZ | 232 | 5,88223 |
| 5PyLA | 232 | 6,04815 |
| 5QbT7 | 301 | 6,53497 |
| 5RQop | 339 | 9,40337 |
| 5S52g | 280 | 9,31170 |
| 5W2Sf | 301 | 6,53656 |
| 5Wy0q | 334 | 9,32588 |
| 5YPGE | 300 | 6,96342 |
| 5ZXRE | 300 | 6,53639 |
| 5oKEF | 255 | 9,68110 |
| 5tDX8 | 249 | 9,28082 |
| 60Aqz | 241 | 9,17322 |
| 62YCx | 226 | 6,22685 |
| 66U11 | 232 | 6,04815 |
| 67Zzk | 232 | 5,57320 |
| 685vN | 301 | 6,23799 |
| 6HAnq | 253 | 9,57531 |
| 6HzRU | 253 | 9,57499 |
| 6amvD | 301 | 5,99818 |
| 6cesl | 232 | 6,04962 |
| 6dpg0 | 232 | 6,22867 |
| 6elSB | 232 | 5,72212 |
| 6elqs | 232 | 5,87996 |
| 6hp65 | 300 | 6,96439 |
| 6k8Wj | 232 | 6,22867 |
| 6ljbT | 232 | 6,04127 |
| 6nO8r | 338 | 9,34864 |
| 6niJ5 | 325 | 9,20797 |
| 6nmhD | 232 | 6,04815 |
| 6qNWf | 232 | 5,88343 |
| 6t8b2 | 301 | 6,23810 |
| 6v0Jh | 301 | 6,53372 |
| 7OGth | 338 | 9,34864 |
| 7XtAY | 339 | 9,30874 |
| 7aKQv | 279 | 9,19366 |
| 7pZUA | 248 | 9,59111 |
| 7uCVT | 303 | 9,45617 |
| 7zqif | 338 | 9,24859 |
| 81O8l | 251 | 9,64404 |
| 81lfA | 236 | 5,47169 |
| 82nUx | 254 | 9,48834 |
| 84bYP | 280 | 9,17967 |
| 87QZu | 295 | 4,64968 |
| 8fjam | 196 | 8,98401 |
| 8jqP3 | 303 | 9,51710 |
| 8lKzE | 232 | 6,04815 |
| 8mKZn | 232 | 6,04815 |
| 8rAPv | 295 | 4,66588 |
| 8vrUt | 232 | 6,22867 |
| obsN | 233 | 9,68936 |
| A0A8S5N8U2 | 232 | 9,40698 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_36427
10262
|
294 | 58,5% | 193 | 2.858E-71 |
| 2 |
phalp2_30104
38LMY
|
4 | 42,7% | 201 | 3.427E-39 |
| 3 |
phalp2_21505
8k22n
|
3 | 27,5% | 225 | 2.566E-22 |
| 4 |
phalp2_30683
6W6ka
|
7 | 26,6% | 214 | 3.758E-18 |
| 5 |
phalp2_36439
13b8a
|
1 | 23,2% | 267 | 2.691E-14 |
| 6 |
phalp2_4897
5Vd10
|
91 | 23,8% | 306 | 9.423E-08 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(76YNm)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50