Protein
- Protein accession
- 2UjMN [EnVhog]
- Representative
- 1DO8y
- Source
- EnVhog (cluster: phalp2_1444)
- Protein name
- 2UjMN
- Lysin probability
- 98%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MSSDPISVVLHNEGGFVNHKADKGGPTKFGVTIRTYSQYLGRPASLQEVKDMTEDTAREIYERSYLTGPRIHLLAEPLRTHLLDMAINHGPVNAIRMLQRVVNAAGFGPISVDGVLGPRTRDAITAAQKKMGKLLNNALVDERVRFFNSIVARDPSQAVFIDGWLNRAEEFRIA
- Physico‐chemical
properties -
protein length: 174 AA molecular weight: 19282,8 Da isoelectric point: 9,34 hydropathy: -0,25
Representative Protein Details
- Accession
- 1DO8y
- Protein name
- 1DO8y
- Sequence length
- 192 AA
- Molecular weight
- 21408,15680 Da
- Isoelectric point
- 5,80704
- Sequence
-
MSDRIDQMIAVIIKNEGDKYTNIPGDKGGPTKDGITLKYAHGVGFISMDLDHDGDVDERDIMLVTAELAATLYRHDFFEAPRISRLPVELQPQVFDTAVNSGPPRSIQMLQRTLGKLGYRTDVDGVIGPEVISKANAACTALGWAVVNDAVVDTRKEFYRVIVKMDPSQQKFIHGWINRAESWYVDKRKIGS
Other Proteins in cluster: phalp2_1444
| Total (incl. this protein): 138 | Avg length: 186,0 | Avg pI: 8,30 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 1DO8y | 192 | 5,80704 |
| 10Quv | 171 | 9,59543 |
| 10o0Y | 191 | 8,71066 |
| 15O72 | 192 | 5,91469 |
| 164Mu | 172 | 8,81549 |
| 16Gon | 183 | 8,90542 |
| 176zT | 181 | 5,19283 |
| 1IHmV | 184 | 5,63470 |
| 1KQxz | 162 | 8,94907 |
| 1gOU5 | 186 | 9,66299 |
| 1jZi0 | 178 | 6,10021 |
| 1m6RE | 197 | 8,99871 |
| 1mgNx | 197 | 8,99871 |
| 1nmxI | 194 | 9,51052 |
| 20HJC | 229 | 5,23961 |
| 2AmCr | 173 | 5,19647 |
| 2BUhk | 183 | 5,48078 |
| 2BqVS | 170 | 9,71405 |
| 2C3Sf | 168 | 9,86091 |
| 2C6vU | 180 | 9,20565 |
| 2CyfB | 170 | 9,71405 |
| 2GFxT | 205 | 8,44118 |
| 2GGCp | 191 | 8,70222 |
| 2lqHg | 174 | 8,66560 |
| 2yvhx | 180 | 9,20597 |
| 2yvxP | 142 | 7,87805 |
| 38yLu | 171 | 9,92254 |
| 3egGE | 195 | 8,90400 |
| 3einN | 194 | 9,58266 |
| 3fL4P | 196 | 8,32830 |
| 3liB4 | 188 | 9,40131 |
| 3lxlu | 177 | 5,40945 |
| 3me2F | 198 | 9,32234 |
| 3p7CK | 194 | 7,99758 |
| 3seag | 198 | 8,39922 |
| 3t3SU | 188 | 9,46281 |
| 3wqKM | 197 | 9,17896 |
| 3y5yG | 197 | 8,97924 |
| 41cnO | 175 | 9,52109 |
| 44UBT | 175 | 9,12571 |
| 4AZe4 | 181 | 5,44946 |
| 4Gm0C | 188 | 8,48502 |
| 4InLv | 225 | 9,37552 |
| 4JGqn | 233 | 4,99481 |
| 4K1E6 | 177 | 8,03658 |
| 4QGZJ | 176 | 5,76458 |
| 4U0Sc | 182 | 8,88273 |
| 4VZxp | 217 | 6,15097 |
| 4XjTp | 181 | 9,18180 |
| 4XjlK | 180 | 5,18726 |
| 4dGRV | 171 | 9,17445 |
| 4dnxf | 193 | 5,38421 |
| 4ePYg | 154 | 7,80217 |
| 4mu2e | 191 | 8,23334 |
| 4ufcH | 191 | 8,44467 |
| 5BCai | 183 | 5,92390 |
| 5Hi3p | 182 | 6,16251 |
| 5Kvey | 187 | 9,57551 |
| 5LCqm | 187 | 9,55558 |
| 5LjTa | 188 | 9,38519 |
| 5OOFd | 189 | 9,50343 |
| 5PuUs | 198 | 9,73120 |
| 5T9zj | 197 | 9,32679 |
| 5ZgYf | 188 | 9,56648 |
| 5hgYv | 213 | 8,97840 |
| 5nHaa | 230 | 4,98855 |
| 5tgvj | 183 | 5,81266 |
| 5z0VN | 183 | 5,81567 |
| 64CBP | 197 | 8,97924 |
| 64mPf | 189 | 9,51639 |
| 6CSV2 | 169 | 9,75241 |
| 6D8nR | 184 | 5,95050 |
| 6PCdJ | 179 | 6,83093 |
| 6Po96 | 193 | 5,84483 |
| 6RLae | 248 | 5,26928 |
| 6aJjd | 187 | 9,57551 |
| 6fG6b | 188 | 9,12358 |
| 6hNZw | 194 | 7,99764 |
| 6iBHi | 187 | 9,62772 |
| 6j68g | 187 | 9,67163 |
| 6oCrQ | 189 | 9,57789 |
| 6uTms | 197 | 9,17896 |
| 6uf5t | 195 | 8,72981 |
| 6wXA8 | 215 | 8,87983 |
| 6x0EZ | 237 | 7,74087 |
| 6x1nc | 216 | 7,80972 |
| 77AuY | 206 | 7,79012 |
| 7Bunq | 197 | 9,17896 |
| 7FJex | 206 | 9,35483 |
| 7Filu | 174 | 6,98372 |
| 7TGm2 | 172 | 9,54166 |
| 7TKtK | 170 | 10,41598 |
| 7TKtQ | 174 | 9,58898 |
| 7VulL | 181 | 9,22557 |
| 7Zz8x | 186 | 9,69548 |
| 7aKKB | 194 | 9,80076 |
| 7eCw | 180 | 6,91255 |
| 7pmfM | 194 | 9,41395 |
| 7s4m6 | 195 | 7,00878 |
| 7u9Oq | 195 | 9,29765 |
| 88dOZ | 197 | 9,20378 |
| 8AhfG | 169 | 9,45559 |
| 8BdrM | 169 | 9,45572 |
| 8BlDB | 173 | 9,71244 |
| 8Btvh | 168 | 9,61090 |
| 8CP2v | 181 | 5,77214 |
| 8DAGJ | 190 | 9,21119 |
| 8DbVh | 196 | 8,95003 |
| 8DhOC | 196 | 5,48754 |
| 8EOzL | 169 | 9,75241 |
| 8FgKF | 184 | 9,63475 |
| 8Gcfs | 170 | 9,76917 |
| 8Gdl9 | 177 | 9,19953 |
| 8GnFr | 169 | 9,03739 |
| 8GuPA | 173 | 4,84862 |
| 8aQ5o | 148 | 7,81700 |
| 8b4sA | 152 | 6,06378 |
| 8dmuO | 192 | 8,82297 |
| 8fI33 | 170 | 9,98346 |
| 8fPsp | 197 | 9,78599 |
| 8i84i | 177 | 8,54221 |
| 8jI61 | 188 | 9,23408 |
| 8kSkd | 189 | 9,60200 |
| 8qddU | 189 | 9,51639 |
| 8wNtv | 190 | 9,21132 |
| 8xQfj | 175 | 11,25819 |
| 8xjQU | 196 | 5,48754 |
| 8xvC2 | 168 | 9,02804 |
| 8y0HW | 169 | 7,95393 |
| 8zYpQ | 145 | 6,80132 |
| W8EA | 183 | 5,87644 |
| YV8N | 168 | 9,50659 |
| cvDn | 171 | 9,58743 |
| czkI | 176 | 9,12075 |
| g46R | 194 | 9,03694 |
| m834 | 176 | 5,74377 |
| um5e | 190 | 7,90423 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_13016
426A1
|
31 | 42,8% | 182 | 2.278E-66 |
| 2 |
phalp2_12184
6C2VC
|
988 | 35,5% | 177 | 6.285E-57 |
| 3 |
phalp2_23908
1Le4q
|
257 | 35,0% | 180 | 2.259E-53 |
| 4 |
phalp2_37851
4LyyS
|
5845 | 33,3% | 183 | 1.003E-48 |
| 5 |
phalp2_25836
5fx9S
|
68 | 32,7% | 186 | 3.533E-48 |
| 6 |
phalp2_28839
4XJZ6
|
27 | 36,2% | 182 | 2.333E-47 |
| 7 |
phalp2_30611
6uqQp
|
1606 | 31,8% | 182 | 4.377E-47 |
| 8 |
phalp2_12946
360Ik
|
1926 | 32,9% | 182 | 8.212E-47 |
| 9 |
phalp2_23735
PTzZ
|
309 | 32,2% | 177 | 2.890E-46 |
| 10 |
phalp2_14059
8aO3S
|
400 | 31,3% | 182 | 4.901E-45 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(1DO8y)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50