Protein

Protein accession
28HA1 [EnVhog]
Representative
1f8D
Source
EnVhog (cluster: phalp2_23582)
Protein name
28HA1
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MKKTILSISLLAFISTQSMWYGRPIIQPIQIDTLLNAIMAVESNFDSMAYNSKENAVGVLQIRPIMVREVNRLLGEDKYTLKDRWSKAKSIEMFNVIRSHTKNPTDERIARNWNGGWNGHKKKSTLKYWNKVKKQIK
Physico‐chemical
properties
protein length:137 AA
molecular weight:15954,5 Da
isoelectric point:10,17
hydropathy:-0,50
Representative Protein Details
Accession
1f8D
Protein name
1f8D
Sequence length
120 AA
Molecular weight
13901,87580 Da
Isoelectric point
9,48712
Sequence
MIFLFIFILSVQELASDKLINAIIYVESKGDDLAYNSKENAAGCLQIRPIALKEVNRILGYKKYTLNDRWSRVKSIEMFNVIKSNIKSPTDERIARTWNGGYNFSKSSTDAYWQKIKDRL
Other Proteins in cluster: phalp2_23582
Total (incl. this protein): 174 Avg length: 133,4 Avg pI: 9,03

Protein ID Length (AA) pI
1f8D 120 9,48712
10svw 139 6,12613
10zOH 151 7,75144
14GQO 149 9,93627
15Cks 145 6,90818
15ynx 151 8,59314
1Dk2X 144 9,67227
1HTKU 118 9,69535
1KWsI 141 8,45878
1LR9E 129 9,69535
1XiLx 141 6,26891
1ai0Z 133 9,85646
1aiPS 128 9,90713
1hCm 135 9,73223
1iSX7 135 5,56519
1j4nt 140 5,53705
1kV4w 119 9,37965
1laTI 133 9,40292
1lbXF 144 9,66447
1ozIc 136 5,52949
1swut 130 9,86755
1tjVZ 128 9,67453
1usiC 129 9,89598
1vcFY 137 10,04032
1xk3k 102 9,92718
1yX6N 152 8,81549
222nQ 126 9,92428
22SbA 119 9,76711
22rW5 132 9,60574
22tSF 130 9,32911
26lvr 129 9,85182
2FXSe 139 9,99416
2Ghgr 136 9,39254
2I3M1 140 8,81420
2Jn0n 136 9,66479
2KSJ0 127 9,67550
2PaNm 131 8,86635
2QF0s 128 9,63920
2SSiB 150 9,31699
2aZzH 168 9,09696
2cdCe 122 5,63328
2mI18 135 10,09125
2nSvt 133 10,00306
2pPx3 132 9,83202
2qTwZ 119 9,54695
2s8Da 132 9,95767
2u7Zl 127 9,74828
2ub08 129 9,81185
2ucR9 135 9,99822
2yQta 128 9,47803
37Vnq 165 9,73081
3PmJW 133 7,67033
3QKEk 158 8,35151
3QbCD 112 9,86149
3Qbd4 166 5,62680
3Qjwi 133 9,31976
3S9hv 145 9,59994
3Samr 125 9,51652
3brUd 132 9,95690
3gC6 143 6,96388
3neT7 135 10,06153
3njSI 135 8,42249
3no8S 137 8,90587
3xDFf 132 8,44712
3xDkA 153 8,95712
48qN2 130 9,66479
4BhJi 123 9,43432
4DKx0 119 9,51826
4FAFZ 121 9,33871
4G5t2 138 9,88347
4G8FT 140 9,72546
4GW4f 143 9,03719
4GuZk 147 4,95161
4Gv0E 146 4,88374
4Hhp7 176 8,58733
4HwoE 153 7,65896
4IaUZ 132 8,73020
4PCU2 132 9,88057
4PMkv 132 10,00216
4boKq 119 9,51935
4c6Wr 131 9,83067
4fUtA 141 7,63162
4lFuL 152 6,07736
4lMRo 154 9,45469
4mouJ 118 9,18741
4zBpZ 104 8,97576
54d0t 164 9,68961
579lN 136 9,54192
59O1G 119 9,71392
59PGT 119 9,51826
5BFnF 104 8,97576
5EBAL 131 9,99442
5JGTx 166 8,31998
5NoGQ 152 9,29874
5Vo5t 156 9,49176
5hsuM 105 8,61899
5nZ6z 112 9,86149
5qK5F 152 6,07196
5sSOg 129 10,15276
5xjGv 119 9,71392
67aWG 156 9,07046
6AtpI 141 9,55030
6B29H 152 9,42761
6B2Ei 141 8,51732
6B2mx 129 9,48744
6B3Oe 129 9,74860
6B50l 128 9,67556
6B6TW 129 9,74860
6BelO 104 9,78922
6C97b 127 9,60523
6FZdl 114 9,77607
6JPpM 130 9,78851
6NZkD 129 9,44257
6OPah 132 9,91738
6OiRn 129 9,63914
6Ovs9 132 9,96161
6OybD 129 9,63862
6PgoZ 129 9,71211
6UJii 138 5,27832
6UpaT 104 9,22950
6W9j7 133 9,30042
6b3fe 152 8,85713
6vqvf 156 9,35857
6wIca 152 8,89021
7EUBX 129 9,67504
7KcVK 104 8,97576
7LdY8 137 6,56106
7Lm3i 150 7,68068
7NVX 139 9,83712
7PKB 136 9,58885
7Urur 129 9,55056
7ZPiH 129 9,77497
7kPUm 150 8,47548
7rsGI 129 9,40982
81m5U 129 9,63817
826WF 120 9,83222
82k3U 156 9,09741
85wI2 129 9,63817
8AdAO 129 9,55056
8cQz 136 9,08219
8esN 120 9,43741
8hHt0 140 5,75759
8hJiX 104 9,51639
8jXAr 128 9,58621
8ltOA 130 10,09467
8ltaP 147 10,29291
8lv3Y 119 9,91880
8mphf 142 10,65110
8pkkL 129 9,67511
8tWRj 135 10,04728
8tYO7 129 9,77497
8vKvC 111 9,79515
8xlsc 128 6,39600
8yJ4B 138 8,69229
PFIL 157 8,52731
QxAN 144 8,55568
XERh 109 6,28488
ZXl5 146 6,96786
dSvt 119 9,64926
dwDK 145 7,88289
hGgm 139 7,09546
ijr7 113 9,02166
isjG 119 9,60658
itqq 130 9,64416
iwgd 108 8,42055
ixgX 117 9,04448
sstz 129 9,86710
uXG5 128 9,74867
xLHE 140 9,38042
xySc 119 9,54695
ySZs 120 9,07426
A0AAX3JIP0 134 9,40647
A0AAX3JJ77 126 9,64713
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_46
7Exor
250 52,7% 110 1.471E-42
2 phalp2_20516
4eE8g
949 52,3% 105 1.685E-40
3 phalp2_13677
61fFV
187 52,4% 101 5.451E-39
4 phalp2_11808
8aeor
7 47,1% 104 1.763E-37
5 phalp2_32105
6iaas
89 45,0% 102 5.970E-33
6 phalp2_3524
4udWf
232 41,1% 102 2.210E-29
7 phalp2_21013
4IiQ
26 33,8% 118 2.210E-29
8 phalp2_23047
4ccMQ
55 46,7% 107 5.704E-29
9 phalp2_11904
2rHNT
22 43,2% 104 1.073E-28
10 phalp2_33104
4JGEd
92 40,9% 122 2.530E-27

Domains

Domains
Unannotated
Representative sequence (used for alignment): 1f8D (120 AA)
Member sequence: 28HA1 (137 AA)
1 120 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (1f8D) rather than this protein.
PDB ID
1f8D
Method AlphaFoldv2
Resolution 91.34
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50