Protein

Protein accession
27xRs [EnVhog]
Representative
83YaD
Source
EnVhog (cluster: phalp2_6776)
Protein name
27xRs
Lysin probability
97%
PhaLP type
endolysin
Probability: 94% (predicted by ML model)
Protein sequence
MEKKNQFQERVLFERTENLKLVKVRDLRPYFIVSLLVNIVIIASSFDNNQKTIVKYKTIFKDKVEQVAEVMSVSDIELTDEAILKELIEQDCVLPNVALAQFKIESQHFKSEICKENKNIAGIKTSRSEYVIGKNRNHCSYATYRDCIRDYIRIQNRYLENIDGRYAEDGQYVALVRKM
Physico‐chemical
properties
protein length:179 AA
molecular weight:21023,0 Da
isoelectric point:8,57
hydropathy:-0,40
Representative Protein Details
Accession
83YaD
Protein name
83YaD
Sequence length
161 AA
Molecular weight
18515,58330 Da
Isoelectric point
9,37533
Sequence
MKVINKDLTISEVLDLRFPFYTSLVLNLVMAALLIFGTEKIKHIYHTKVVTNIREDVTLNDSALLKELVHLKCVLPNIALAQIKIESSHYKSIIAIENKNICGIKTSKSKYVIGQNRGHCVYNTYRDCLRDYVRIQNAYLKNINHKYAEATGYVDLIKQMK
Other Proteins in cluster: phalp2_6776
Total (incl. this protein): 163 Avg length: 166,3 Avg pI: 9,31

Protein ID Length (AA) pI
83YaD 161 9,37533
15qr0 163 9,25961
18xnt 168 9,41878
1Dw00 167 9,86310
1FsQy 166 9,61870
1JEmI 163 9,15762
1JwFI 164 9,17232
1MLfI 177 9,69690
1NZOe 182 9,33149
1aINR 165 9,39338
1dTof 165 9,64520
1dZtZ 165 9,55043
1eCtY 165 9,62921
1etLq 157 9,43387
1ew7i 168 9,79360
1ewFK 164 9,19140
1ezuS 167 9,25207
1pGDD 169 9,56339
1qiGb 164 9,23498
1xUvm 164 9,21584
20xaW 177 8,80743
25fN4 165 9,44734
277mQ 169 9,59646
27ySB 163 9,07497
2IwwC 138 9,69535
2R3zf 169 9,76698
2Wn9C 182 9,36482
2a2PJ 164 9,66589
2fuDn 169 9,73307
2qqW3 164 9,12081
2s7No 166 9,61870
3091o 163 8,99581
30cAs 169 9,48944
312nn 175 9,20958
320C8 171 9,59439
3335Y 182 9,43574
34al0 164 9,34813
36BgL 173 9,61457
36MWl 169 9,58092
37erq 173 9,43284
38miC 169 9,35496
3S3LR 167 9,83712
3WgJX 164 9,33813
3bfzr 157 9,41169
3dcRo 165 9,59601
43ZX3 157 9,51671
43wML 182 9,51645
46X68 170 9,51684
481ne 175 9,25903
481np 200 9,45095
4FLIV 167 9,18431
4FLr8 136 9,03287
4J79Q 157 9,31995
4NAGz 157 9,41143
4NtdE 167 9,16845
4a586 164 9,34136
4abxX 166 8,89536
4axxo 179 9,13151
4bHgx 169 9,39003
4eCyw 137 8,14321
4eOXp 166 9,34413
4fDzW 168 9,14795
4g9NR 165 9,05518
4gfAt 174 9,18231
4h9Ao 165 9,39338
4lktF 164 9,45746
4m5wk 169 9,60606
4ndxH 166 9,32730
4pUH0 166 9,35586
4ph8G 134 8,64342
4phet 163 8,66308
4pzus 164 9,74796
4qPux 165 9,51813
4saJ7 165 9,56706
4saZQ 129 8,87048
51PMn 129 9,13880
51aP9 164 9,04616
520JJ 196 9,56725
5308r 168 9,11191
54Epx 164 9,04616
54EsB 163 9,04616
54T88 166 9,51813
54zD3 167 9,21590
55TRC 168 9,60581
55pGN 164 9,30048
56Dsu 172 9,63430
57Sdy 163 9,24182
58nht 166 9,67021
5AGfB 164 9,28624
5BUqF 173 9,44057
5aCnZ 163 8,89511
5ah1w 172 9,56828
5bPMH 164 9,20591
5bhsA 182 8,76546
5cNMH 167 9,09805
5cvox 163 9,03371
5daij 164 9,37507
5drMU 164 8,90568
5gDhn 196 9,63288
5h3JN 164 9,32672
5jmgr 165 9,48029
5kHLA 165 9,01798
5ksHn 163 8,64826
5kt0s 179 9,03346
5kuJ5 166 9,35908
5lMBH 157 9,02159
5n3Dm 164 9,30068
5urG9 168 9,63372
5vksJ 167 7,74701
5xPXr 165 9,04628
6GZL1 165 9,49853
6GjtL 168 9,14170
6Gnpr 165 9,19882
6Gntc 167 9,33169
6IJe2 166 9,34368
6Lq3F 166 9,27025
7X7zm 164 9,31576
7qXI1 166 9,61844
805Qc 171 9,21622
80olC 166 9,63456
85TRQ 166 9,56828
85UiF 156 7,68698
86R6E 166 9,35889
87BdA 164 9,41395
87BmH 157 9,41143
87D8P 165 9,47713
88eTe 168 9,69574
8937R 166 9,38597
8iLWL 164 9,23460
8mk3p 157 9,02172
8mkmL 166 9,35908
8oA8O 169 9,46765
8p3Hx 191 9,30048
8rVHN 182 9,31583
8rVLX 166 9,51832
8sFZX 168 9,63972
8sc94 164 9,31615
8sd6V 164 9,41872
BBFb 178 8,93682
FbJq 165 9,37024
G7qN 163 9,30119
GmrR 166 9,58021
IBpY 166 9,38597
IUJZ 166 9,28527
ItHy 174 9,55088
IuXZ 165 9,50150
Iv9T 197 9,55320
IzSQ 129 9,03526
JI7d 163 9,26515
KvMS 165 8,69616
L2wo 164 9,18476
MkZH 154 9,08625
RMnn 163 9,37836
TOBx 196 9,48061
UaA3 157 9,41143
UdKk 163 9,03462
avgm 170 9,30048
dPJ0 171 9,37224
jCOj 166 9,58698
x6lc 166 9,35908
xhn0 167 9,25903
yZ8V 176 9,51806
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_37081
14SWF
8 40,1% 127 1.489E-30
2 phalp2_39474
58CQt
17 35,0% 134 7.180E-30
3 phalp2_24545
7HQNr
274 24,4% 143 1.673E-22
4 phalp2_32846
31z3H
398 27,0% 174 3.847E-21
5 phalp2_33922
20wTw
220 25,9% 177 2.256E-19
6 phalp2_31057
1I3Gw
1 29,2% 99 2.757E-18
7 phalp2_40200
2dngU
73 29,1% 137 7.044E-18
8 phalp2_38265
eDdp
15 29,0% 110 1.172E-16
9 phalp2_5845
5o5rF
7 24,6% 130 2.189E-16
10 phalp2_22607
1LayP
7 27,0% 122 1.261E-14

Domains

Domains
Disordered region
GLUCO
Representative sequence (used for alignment): 83YaD (161 AA)
Member sequence: 27xRs (179 AA)
1 161 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01832

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (83YaD) rather than this protein.
PDB ID
83YaD
Method AlphaFoldv2
Resolution 85.61
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50