Protein
- Protein accession
- 23dG7 [EnVhog]
- Representative
- 3WNZr
- Source
- EnVhog (cluster: phalp2_37584)
- Protein name
- 23dG7
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MKTDIFIKACNDMNARMIASQKSGAKWAYYNSKTSSSFEKALADKNYRVNCATTPVWALKTAGIIPLNLAGFYGEKNSEIKWKSAATKVAVEKECTVITIGGKKTVSAAIKDGTIKAGDIVTYVDIRHTNVYLGNGKWLDSGHAYSKGSGDGATFSTWIGKTVYGSRKIGSIIRLKEDSVKPVVKYRVQIGAYKVKKNADAMAVKAKEKWFDCIVKLYGDYWVVQCGIYTVKTNADALVNKLKAAGFSAAIVKM
- Physico‐chemical
properties -
protein length: 254 AA molecular weight: 27744,9 Da isoelectric point: 9,69 hydropathy: -0,16
Representative Protein Details
- Accession
- 3WNZr
- Protein name
- 3WNZr
- Sequence length
- 319 AA
- Molecular weight
- 36346,68240 Da
- Isoelectric point
- 9,64913
- Sequence
-
MVAIFYVKGARVAMKDIYAVQRTLKDSENRLGLFHELENAKRLADQYWGFNVYNIETKKLVYKPAIKKSQALVGALLYMDRVVRREITEGYVWRYSNGSLKKENTFAKARANNLRNVNCVDGVQWGIKMSKITTGDGLSWYGLNGGFRWLRKDSEARAKRYFNIISFDMKPKKAIKYGLLHPGDTCTFYGMAHTNCYLGTKPGEEGNDWFFDSGHANCTCGGERAPFRCFTKRLPYNGKMGLILRPIDGVFRVQCGVFNSKLLAKRRLNLVKKAGFDVKLERDGKEYVVQAGLFDIEENAINLSRKIDEAGIPVLVKEI
Other Proteins in cluster: phalp2_37584
| Total (incl. this protein): 19 | Avg length: 254,7 | Avg pI: 9,60 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 3WNZr | 319 | 9,64913 |
| 21DIb | 251 | 9,50846 |
| 21H2Q | 252 | 9,83725 |
| 21njl | 248 | 9,45424 |
| 23JzC | 250 | 9,90204 |
| 23cG3 | 252 | 9,73352 |
| 23wQL | 248 | 9,54024 |
| 24Bsx | 252 | 9,81597 |
| 24CGy | 248 | 9,50349 |
| 3TJ8N | 250 | 9,83641 |
| 3VGKg | 248 | 9,32221 |
| 3dNB7 | 248 | 9,43793 |
| 3gVKO | 251 | 9,41330 |
| 3h370 | 248 | 9,44335 |
| 41jjb | 248 | 9,58337 |
| 4L5sr | 250 | 9,85549 |
| 4kcpM | 250 | 9,56339 |
| 4kmAl | 273 | 9,31673 |
Similar Clusters
No similar clusters were found for representative 3WNZr.
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(3WNZr)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50