Protein

Protein accession
20wvT [EnVhog]
Representative
4nryL
Source
EnVhog (cluster: phalp2_4622)
Protein name
20wvT
Lysin probability
82%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
LRIIAGWVTSVVFFAFGAFAPGTPQGGDQISLKSFNPSVVADRAEPRIATKKVFFAHGDVSWLPELALAAGWPKKAIPRLTQIILRESGGCPNRRGGDIVDKNCNITGVSTYSHRSDTGLLQINGVNYNPARNKWALICREMQICTQEPLLDPLTNLKAGFVLFKASGWGPWDPCQWGPEYASRCKAGN
Physico‐chemical
properties
protein length:189 AA
molecular weight:20629,5 Da
isoelectric point:9,28
hydropathy:-0,14
Representative Protein Details
Accession
4nryL
Protein name
4nryL
Sequence length
177 AA
Molecular weight
19912,65800 Da
Isoelectric point
9,06911
Sequence
MRIFTRLTAALTVGLIAFGSIVYAAEAPANPPFQTYTPLREGPIASERRLETPIVFRHGDISWLPQLAAQAGWPERTWKRLGHIILRESGGCPNRRGGDAVNKFCEITHVTEWNHRSDTGLLQLNGVHWKQDHPQYAGLICKQMGICTQEPLLDPLTNLQAGLLLWQVAGWQPWKRS
Other Proteins in cluster: phalp2_4622
Total (incl. this protein): 166 Avg length: 181,5 Avg pI: 8,71

Protein ID Length (AA) pI
4nryL 177 9,06911
12YCX 175 9,47448
17VJy 177 8,98136
18F1U 177 8,78506
18Kwa 183 8,22360
18oJJ 156 8,76533
19E8d 173 9,29720
19HMv 175 9,33420
19Nn4 177 9,55023
19SL2 162 8,43467
19VMW 187 8,24726
1DIFs 188 9,16794
1JJkh 183 8,88131
1JUU9 187 8,25474
1JoBU 173 9,20978
1JtIG 177 9,47365
1NOLt 173 9,20668
1OBuU 188 8,89704
1h5bG 190 8,77932
1iyS4 169 6,95223
1jvdw 195 8,58720
1y8GY 177 9,00109
1ydAm 183 8,88131
1zcP4 183 8,71337
1zl0S 184 7,70614
21cKs 187 8,58353
27OAS 258 9,84034
27xxi 173 9,38500
2RSQu 177 9,38436
2W0yQ 188 9,05402
2WYbT 190 8,24733
2XCZg 184 8,55877
2XXGC 218 8,83238
2YeJi 185 7,69068
2iIKu 179 7,59206
2jawi 187 8,56748
2ln8j 230 9,78019
30MG3 177 9,04454
30pIG 228 9,70960
30qg9 228 9,72971
30rkD 256 9,24459
31IpR 187 6,80609
31Osa 174 8,83496
31vyd 177 9,45682
31w79 187 6,40367
32VFV 187 8,80859
33zxY 183 9,02082
35ajl 181 9,50749
37gd1 184 7,68176
37qG6 173 7,68789
37zk7 178 9,45908
38kWr 186 8,80253
38pYc 183 8,94249
3XRGG 181 6,51030
3bnGi 180 9,02179
46uAZ 173 9,13132
47B1W 198 9,16626
49Ews 161 9,41962
49IgJ 175 9,18199
49Wxa 176 9,54649
49es3 177 8,78061
49wK0 173 8,98510
49wuc 178 8,76346
4AucR 179 8,39954
4DO4p 220 9,48725
4GEIO 177 9,58530
4NHBo 181 8,97079
4NJ5r 178 8,79679
4Or0g 173 9,35618
4aAbI 181 8,51094
4au4I 184 8,13773
4bNho 173 6,72049
4h4Eg 190 8,24249
4kFKo 179 9,23859
4lWWn 196 8,53795
4m5Q3 178 8,22122
4mMNj 167 9,03881
4nDYP 224 9,03687
4qJUM 173 9,35612
4qbRL 193 8,92083
4rAH2 179 8,75095
4rk6w 184 8,77326
4s9a1 174 9,50581
4wua4 200 9,13654
4zRFs 178 8,79731
50U2r 173 9,54649
52moX 187 8,22573
54tfa 140 8,41366
56DTS 177 9,32575
56IIU 187 7,60110
56NOO 162 8,74754
57CLU 176 8,18898
57UjP 198 8,74148
58TxL 173 8,55368
59pbF 162 7,71131
59wvp 179 7,58320
5Bv0V 178 8,73400
5DrYL 179 8,41050
5a7KN 187 7,60053
5a98b 162 5,59037
5aGzJ 214 9,64468
5aePl 177 8,78061
5bLTN 184 9,09715
5cYzN 190 8,55852
5ckqu 175 9,91906
5cmhX 173 9,18470
5dmuH 180 7,66630
5eF55 175 9,80869
5f3SH 177 9,23415
5fiZ2 179 8,62711
5fvRT 177 8,78061
5gkok 162 8,42565
5hucj 173 9,32756
5iGkh 179 7,58820
5kRXP 173 5,18573
5mgwe 191 6,87942
5ntMU 179 8,10079
5thLV 187 8,58289
5uMQD 173 9,35618
5z6sb 177 9,50066
6KwKe 180 7,62872
6MfGb 172 8,80962
6Mrxo 140 8,41005
6SVTD 173 9,00090
6xMKZ 140 9,00135
6yeLr 175 9,60954
6z6BV 174 8,79757
7KanA 218 8,65993
7Xajo 177 9,20765
7Y2l 190 9,11552
81TJo 173 6,72692
81Ute 177 9,50066
81VgJ 177 9,23415
82RAK 187 8,59307
8E5B8 184 8,89311
8FVRj 177 9,64681
8bF2V 174 9,20771
8bm1Y 187 7,61969
8dZkr 179 8,75095
8e914 220 9,50536
8npSp 190 8,58289
8nwNx 187 8,82148
8oS8a 177 9,18186
8ohao 177 9,38442
8rvtP 177 9,50066
8t4rc 169 8,74883
8y3YA 184 9,97244
AdH6 137 8,96370
C9xw 182 8,72014
CfSJ 187 7,61326
ChdX 180 8,23282
EvoT 187 8,25468
H5FB 190 8,76836
RXuZ 181 8,88099
SOqV 181 8,70389
ST6I 173 8,77984
SwXT 179 9,11378
Ue78 177 8,76436
Ugtm 179 6,92938
X8vf 173 9,72823
dShX 173 9,99094
iTF9 164 8,94500
qyLm 170 7,70642
zS4n 178 9,63430
A0A1B0XUK8 180 7,69551
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_40522
4GjG8
210 72,9% 122 2.068E-72
2 phalp2_24419
4oWdT
7 73,8% 111 8.790E-64
3 phalp2_8459
165nm
626 32,8% 125 3.326E-13
4 phalp2_26521
7XVtu
369 25,4% 185 7.271E-12
5 phalp2_3718
5j50L
31 34,8% 132 1.346E-11
6 phalp2_3862
6IDp9
274 24,1% 178 4.605E-11
7 phalp2_8391
CgjB
207 28,9% 114 6.262E-11
8 phalp2_27902
jLnT
10 29,8% 114 2.905E-10
9 phalp2_33775
1865r
7 32,2% 121 4.563E-09
10 phalp2_34455
4DPBl
20 25,0% 144 4.563E-09

Domains

Domains
Disordered region
Unannotated
Representative sequence (used for alignment): 4nryL (177 AA)
Member sequence: 20wvT (189 AA)
1 177 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (4nryL) rather than this protein.
PDB ID
4nryL
Method AlphaFoldv2
Resolution 81.16
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50