Protein

Protein accession
1zmgw [EnVhog]
Representative
72lJ7
Source
EnVhog (cluster: phalp2_6321)
Protein name
1zmgw
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MKHNWDEALLHILKYEGGYVNHPSDPGGMTNLGVTKRVWEEWTGKPATEADMRALTPEMVGPLYK
Physico‐chemical
properties
protein length:65 AA
molecular weight:7368,3 Da
isoelectric point:5,82
hydropathy:-0,66
Representative Protein Details
Accession
72lJ7
Protein name
72lJ7
Sequence length
117 AA
Molecular weight
12600,98090 Da
Isoelectric point
9,04616
Sequence
MDRNFARALPLVLKHEGGWADNPKDPGGATMNGVTLATFRRYVKADASKADLRAISDDQVATVYYRHYWAAVNAQALPSGIDYAVFDFAVNSGPARAARYLQSIAGVSVDGRVGPQT
Other Proteins in cluster: phalp2_6321
Total (incl. this protein): 149 Avg length: 132,1 Avg pI: 6,55

Protein ID Length (AA) pI
72lJ7 117 9,04616
17Val 61 5,44986
18lbL 106 4,64093
191Qs 63 6,00893
1FdVl 180 6,31489
1JE9l 83 5,63254
1Jy36 119 6,07083
1K48I 117 7,68471
1Lwwu 164 9,04358
1Um24 120 4,97673
1W7qd 119 8,33662
1cL3X 80 5,17305
1fpWs 169 5,26598
1g8GQ 92 5,72922
1jcz1 115 6,03558
1jziv 116 5,41871
1lrUx 164 8,99954
1uJpT 112 5,65851
1uNqU 109 5,86370
1uSja 122 5,03880
1vPen 74 6,03001
1wCFC 95 6,03644
1wpPj 85 5,03755
202DJ 105 4,96502
28WFe 170 6,83014
29K12 96 5,86979
2Bo87 124 10,08674
2DVU3 95 4,46501
2ESm0 99 4,98327
2FyK9 137 6,08714
2Jsrd 97 4,66793
2V0GI 109 8,50469
2W4X4 130 5,66892
2XcIS 170 9,22602
2XteE 66 5,40984
2uphk 111 5,20358
31Zgn 112 4,88568
32zWj 89 5,70740
33GG4 92 5,18499
35etT 110 6,07219
37jyb 113 5,22665
39N1n 92 5,45026
39Tbo 116 5,73525
3Ejsk 91 6,02797
3FWx9 106 6,07634
3GpO5 127 5,34999
3NaVR 93 4,87306
3Rldu 170 9,20965
3Wdez 170 6,09015
3Z6vA 86 5,43968
3ZphS 165 9,66525
3dfJ2 108 5,63942
43lUX 118 5,15413
468wR 82 5,01487
46gnT 104 5,85558
4WuQI 204 9,32659
4a1ud 98 6,73038
4aV9l 87 5,24314
4acvE 94 5,84336
4bKCd 83 5,26758
4e1xD 225 10,19086
4eSnR 160 9,00006
4nhY0 109 6,71043
4owlp 124 6,71788
4quSH 95 5,24063
4t4ni 172 5,67579
4w0IU 161 6,23310
4wJE5 175 6,83099
509vw 93 5,25433
50hNW 176 8,43532
56HAP 79 5,72593
5ILVF 103 4,76563
5hFfV 68 6,99798
5kRDJ 98 5,49255
5rDxX 107 6,05565
5wf2f 119 6,27351
6A0up 105 5,72922
6Bk7j 179 8,95919
6BlCo 184 5,97687
6CDgy 81 6,53969
6CStf 76 6,39572
6DXbM 101 7,83202
6HNA3 167 4,79797
6IByD 83 5,63203
6IKdS 170 5,91003
6KvSj 106 5,11059
6McOW 97 7,77008
6VfI4 158 7,79334
6Vgvd 158 7,77213
6cDw 158 8,17777
6y4QN 101 6,05923
6zKY6 98 6,18115
7CwFc 118 5,49510
7EMUl 66 5,73638
7HOtY 164 8,02569
7HjKR 80 4,82577
7KMi0 114 5,25035
7LL1Y 88 4,46473
7dspE 118 5,68040
7yvkI 155 7,83209
8AFla 169 6,52218
8BE8g 126 8,95158
8BNeq 101 5,27406
8BWYq 169 6,97269
8ByMR 169 6,52099
8D98P 96 5,26240
8F5TH 108 4,95803
8GCfa 170 6,96701
8GJzg 116 4,79110
8GdfW 159 5,50164
8GjuY 170 4,52344
8l1Yc 169 5,97443
8lwjt 119 6,26078
8wUTc 171 5,02556
8xH2G 168 4,84577
8xMsJ 170 6,21360
8xWtq 169 7,01765
8xg2R 168 4,92512
8xqNn 172 5,41394
8z4cA 159 5,34152
8z7Rt 140 5,81045
8zF9u 73 6,54708
8zufl 169 5,76327
FPaH 125 5,91185
FWj1 149 5,43713
FoIt 71 5,13355
I6ZB 173 10,71395
MCDC 70 5,72149
MwFP 70 5,72149
Z3r6 119 7,75434
ab7h 77 5,22682
eFAA 96 4,66764
tPFu 118 4,95803
w0Et 114 5,12332
y8R8 170 9,11346
M4QPK9 209 9,54836
A0A1L7QX96 241 10,10956
A0A1L7QNW6 241 10,05760
A0A1L7QP04 241 10,10956
A0A1L7R181 241 10,10956
A0A6C0X257 283 9,89101
A0A6J5KKJ2 179 8,88937
H2EIC4 241 10,10956
V6F994 241 10,10956
X2CXR6 241 10,10956
X2CXV0 241 10,10956
X2CYH6 241 10,10956
X2CYM6 241 10,10956
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_12946
360Ik
1926 50,4% 115 3.461E-67
2 phalp2_37851
4LyyS
5845 48,3% 118 7.773E-55
3 phalp2_23908
1Le4q
257 49,1% 118 2.879E-51
4 phalp2_25028
ZsUq
3460 38,5% 114 1.401E-43
5 phalp2_30515
5lEwY
188 40,3% 109 6.805E-43
6 phalp2_21282
1uMBM
118 39,4% 71 5.197E-40
7 phalp2_18063
3IzUl
9 40,4% 99 8.940E-39
8 phalp2_31569
4hIyC
214 37,6% 101 1.929E-36
9 phalp2_2772
4xQC
10 36,5% 126 3.318E-35
10 phalp2_1444
1DO8y
138 35,1% 131 1.175E-34

Domains

Domains
Representative sequence (used for alignment): 72lJ7 (117 AA)
Member sequence: 1zmgw (65 AA)
1 117 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF05838

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (72lJ7) rather than this protein.
PDB ID
72lJ7
Method AlphaFoldv2
Resolution 91.06
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50