Protein
- Protein accession
- 1zgSL [EnVhog]
- Representative
- 1B37v
- Source
- EnVhog (cluster: phalp2_695)
- Protein name
- 1zgSL
- Lysin probability
- 98%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MIAEILVCAALITAPACVANSTAAEDWKGYEPSLYTGQHYDSKWAGVRKCIMHRESRFNYRARSSISTASGAYQFLDSQWRVSLTHMMIKESRATADGLIEDIKALRDKPIEKWNRYYQDRAFFTAWDNGRGADHWNQTRHGC
- Physico‐chemical
properties -
protein length: 143 AA molecular weight: 16412,3 Da isoelectric point: 8,71 hydropathy: -0,56
Representative Protein Details
- Accession
- 1B37v
- Protein name
- 1B37v
- Sequence length
- 178 AA
- Molecular weight
- 20444,05060 Da
- Isoelectric point
- 9,51800
- Sequence
-
MKSKLLGGVLTMVMVTAIASPAMAKGTPETVYAKSAPTATVSVVYKSLEHRAARSDESKDMMGYEKSLYRGKWYDSKWEGSRKCIMSRESHFNYRAANKSSSARGAYQFLDTQWRDGLVWMMLKESKKNSDGLASEIKELFEKPIDKWSRYYQDRAFFTAWQHGAGSKHWYYPGHNCY
Other Proteins in cluster: phalp2_695
| Total (incl. this protein): 117 | Avg length: 155,1 | Avg pI: 9,34 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 1B37v | 178 | 9,51800 |
| 13KnA | 187 | 9,82306 |
| 14b8k | 143 | 9,56345 |
| 14bWC | 188 | 9,91512 |
| 14d8o | 143 | 9,34078 |
| 15ct5 | 230 | 10,27911 |
| 1AMDk | 198 | 9,69484 |
| 1HWrR | 187 | 9,82306 |
| 1I7OH | 148 | 9,50530 |
| 1JlR0 | 143 | 6,95098 |
| 1RE40 | 143 | 9,90481 |
| 1hcW0 | 133 | 10,00699 |
| 1hdKq | 192 | 9,86587 |
| 1hdgr | 187 | 9,79928 |
| 1q9Sq | 143 | 9,29855 |
| 1smvt | 143 | 8,70557 |
| 1tLqp | 143 | 7,00122 |
| 1zX7a | 113 | 10,18847 |
| 22Vxu | 178 | 9,73822 |
| 22X4a | 178 | 9,82210 |
| 29Wx9 | 143 | 9,34110 |
| 29YTE | 143 | 9,56306 |
| 29ZaG | 192 | 9,58279 |
| 29al8 | 138 | 9,63366 |
| 2ENDu | 143 | 8,96299 |
| 2EOT5 | 143 | 9,32459 |
| 2EQeU | 143 | 9,15762 |
| 2FO1E | 143 | 9,13615 |
| 2FPpf | 143 | 8,94468 |
| 2FZNS | 180 | 9,67408 |
| 2Fa5a | 147 | 9,44212 |
| 2FakB | 143 | 8,96235 |
| 2GXE0 | 143 | 9,29842 |
| 2GdjC | 138 | 9,72443 |
| 2GiWn | 143 | 9,66234 |
| 2Gk7i | 143 | 9,53753 |
| 2Nzj | 143 | 8,74954 |
| 2O6m | 154 | 6,20377 |
| 2PYbu | 143 | 9,66196 |
| 2R1O9 | 147 | 9,59433 |
| 2a01x | 138 | 9,45785 |
| 2a7fT | 179 | 9,63449 |
| 2azTt | 143 | 7,71989 |
| 2dxfK | 143 | 9,41350 |
| 2gT0z | 176 | 9,83447 |
| 2ghav | 187 | 9,84434 |
| 2hpKU | 187 | 9,84434 |
| 2iRrN | 174 | 9,79012 |
| 2kcLV | 154 | 8,90523 |
| 2kmVF | 127 | 9,26922 |
| 2kr3E | 143 | 9,15775 |
| 2l7Ee | 143 | 9,15788 |
| 2l9U8 | 143 | 9,44180 |
| 2nDwL | 138 | 9,69374 |
| 34ITv | 143 | 8,96241 |
| 359Tb | 180 | 9,77652 |
| 39TFg | 143 | 9,18096 |
| 39VjX | 160 | 10,31225 |
| 39Vkc | 143 | 9,44180 |
| 3QT0 | 150 | 8,56651 |
| 3Ty7 | 143 | 9,18096 |
| 4CQ8t | 143 | 8,98136 |
| 4CQg2 | 154 | 6,90931 |
| 4CQjv | 143 | 9,15756 |
| 4CQlc | 143 | 9,15801 |
| 4KKY1 | 143 | 9,18096 |
| 4KTXI | 146 | 9,44180 |
| 4KjpO | 147 | 9,29906 |
| 4Kjrf | 169 | 9,57551 |
| 4Kjsx | 146 | 9,32466 |
| 4KkFa | 143 | 9,13557 |
| 4KkIT | 143 | 9,32453 |
| 4Kkx2 | 169 | 9,61851 |
| 4KkzN | 143 | 9,32472 |
| 4KnXd | 143 | 9,29829 |
| 4NsSL | 143 | 6,19002 |
| 4WweU | 175 | 9,69587 |
| 4XDR8 | 203 | 9,73133 |
| 4XECc | 143 | 9,18122 |
| 4XEKg | 143 | 9,15762 |
| 4chEG | 143 | 8,73361 |
| 4jkCa | 143 | 10,18725 |
| 4pMn1 | 179 | 9,39377 |
| 4pucr | 143 | 8,94468 |
| 4pxIv | 179 | 9,45998 |
| 4zPSL | 175 | 9,79889 |
| 507mv | 143 | 9,11533 |
| 508tT | 179 | 9,47822 |
| 51vWh | 142 | 8,88331 |
| 544g2 | 143 | 9,29823 |
| 58h2l | 140 | 9,92254 |
| 5aFXq | 143 | 8,70505 |
| 5bcFO | 143 | 9,23092 |
| 5gcll | 179 | 9,53644 |
| 5h8QA | 143 | 9,36347 |
| 5x2Xm | 143 | 9,41330 |
| 5yh5a | 175 | 9,61593 |
| 5yjxr | 148 | 10,00486 |
| 6AEDz | 143 | 9,25129 |
| 6LFMm | 146 | 9,38900 |
| 6xGQd | 143 | 9,25155 |
| 6xYzz | 139 | 9,44160 |
| 7VJuO | 137 | 10,22328 |
| A7rs | 192 | 9,81069 |
| AwpV | 143 | 9,25194 |
| Ecy2 | 184 | 9,88450 |
| PoZm | 169 | 10,06076 |
| Prc8 | 174 | 9,78342 |
| TknQ | 137 | 9,25187 |
| X66u | 133 | 9,80630 |
| dQSY | 166 | 10,07913 |
| kqkq | 158 | 9,25084 |
| lqXl | 143 | 9,53960 |
| zOPL | 175 | 9,89939 |
| zQmc | 203 | 9,73126 |
| zVtG | 169 | 9,76014 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_30476
4X9qO
|
3 | 72,2% | 119 | 1.098E-55 |
| 2 |
phalp2_708
1FtLz
|
14 | 58,9% | 134 | 6.607E-54 |
| 3 |
phalp2_32811
2GfCO
|
95 | 57,9% | 119 | 4.672E-44 |
| 4 |
phalp2_28019
6Vmwl
|
15 | 36,1% | 191 | 8.229E-31 |
| 5 |
phalp2_19728
4NMTi
|
55 | 36,9% | 130 | 2.816E-24 |
| 6 |
phalp2_21967
7HbLZ
|
2 | 29,7% | 141 | 2.512E-13 |
| 7 |
phalp2_11241
6DcUB
|
1 | 25,4% | 173 | 4.671E-09 |
Domains
Domains
1
178 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(1B37v)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50