Protein
- Protein accession
- 1tpPx [EnVhog]
- Representative
- t4Qh
- Source
- EnVhog (cluster: phalp2_28237)
- Protein name
- 1tpPx
- Lysin probability
- 96%
- PhaLP type
-
endolysin
Probability: 95% (predicted by ML model) - Protein sequence
-
MKKEDAVLQFLIQEEGFKPRTYIPKKDGKAIGNSGLTFGVGIDIGQMNTKEFLNMGLPKEFEESLLPYVGKKGAEALAVEKELGHYTLPTDVAMNISRQKINKSKDRMRSKYKNYDELPYQQQAVGLSLLHNFGDSSLDFGTMKSVMGGDLKSGIARLRNADEWKNPELF
- Physico‐chemical
properties -
protein length: 170 AA molecular weight: 19081,7 Da isoelectric point: 8,63 hydropathy: -0,57
Representative Protein Details
- Accession
- t4Qh
- Protein name
- t4Qh
- Sequence length
- 187 AA
- Molecular weight
- 21445,88950 Da
- Isoelectric point
- 9,72062
- Sequence
-
MPLDINWKFLLEVEGRTRRGYVPKDKDGVIGQSGVTIGKGIDIGQMSILQLQKLDISDRVRAMLIPYAEKKREAAVAMLRTRPLFMEWADVEELEKAVIARELGLLIKYYNRDSKVKFQDIPTQAQTVLLSLVWNFGADLPGKLPTTWKMATRQEWVKLADYLSDFPGKQKKLDGRRKREAALLRTI
Other Proteins in cluster: phalp2_28237
| Total (incl. this protein): 121 | Avg length: 207,3 | Avg pI: 8,13 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| t4Qh | 187 | 9,72062 |
| 109BH | 195 | 9,13396 |
| 147Em | 209 | 5,30441 |
| 14drx | 211 | 7,91048 |
| 19eqm | 240 | 8,75476 |
| 1HOMQ | 204 | 7,90951 |
| 1JvL | 203 | 7,90951 |
| 1kWhC | 205 | 9,15008 |
| 1qx7k | 208 | 9,20023 |
| 1tApz | 195 | 9,15375 |
| 1tqVH | 195 | 8,95964 |
| 1uguc | 201 | 9,32118 |
| 20NB8 | 212 | 8,70892 |
| 21YDb | 194 | 9,17471 |
| 23EZS | 210 | 9,09289 |
| 23Foy | 216 | 8,89743 |
| 25ST7 | 211 | 6,76528 |
| 2Bz9B | 211 | 7,89959 |
| 2GIrc | 211 | 6,92398 |
| 2K4Bs | 208 | 6,33098 |
| 2QHw3 | 211 | 9,32169 |
| 2WyLI | 203 | 5,15987 |
| 2eR3O | 204 | 7,87844 |
| 2jtK1 | 204 | 7,88837 |
| 2jtbz | 211 | 6,44323 |
| 2mHX1 | 211 | 7,89926 |
| 2mlbl | 205 | 9,13428 |
| 2nKZC | 204 | 7,87844 |
| 2qYOQ | 204 | 6,31358 |
| 2qjsQ | 204 | 6,91875 |
| 34Mx6 | 204 | 6,43528 |
| 34Qi0 | 211 | 6,44318 |
| 35Adf | 204 | 8,75495 |
| 37RPu | 221 | 7,52130 |
| 3JbOT | 197 | 6,57453 |
| 3TDhZ | 216 | 8,89749 |
| 3TFq5 | 215 | 8,70331 |
| 3TKWx | 216 | 8,54872 |
| 3VClx | 203 | 7,88830 |
| 3WIsE | 215 | 8,83483 |
| 3ZBqx | 210 | 8,92702 |
| 3ZHBZ | 212 | 8,79099 |
| 3dVlo | 207 | 9,19998 |
| 3gPvA | 209 | 8,36775 |
| 3gUsf | 205 | 8,58359 |
| 3j10E | 207 | 6,83144 |
| 3lOEa | 210 | 9,66486 |
| 3me0k | 208 | 8,92882 |
| 3miGy | 210 | 7,73535 |
| 3mqIi | 163 | 6,73811 |
| 3ms1F | 210 | 9,32492 |
| 3nv5n | 208 | 9,84434 |
| 40dB6 | 228 | 8,49772 |
| 40j8A | 219 | 8,55678 |
| 42BBK | 195 | 9,32105 |
| 48rPY | 195 | 9,51974 |
| 4L6eT | 213 | 8,81916 |
| 4QLBp | 201 | 6,17319 |
| 4k9P9 | 219 | 8,96422 |
| 4kh56 | 214 | 7,64214 |
| 4qJuu | 190 | 10,83000 |
| 4v61B | 212 | 7,88888 |
| 4xF93 | 240 | 8,99535 |
| 4xojW | 205 | 6,92051 |
| 4xp2D | 210 | 9,82268 |
| 5FjWF | 203 | 6,92023 |
| 5SZZB | 298 | 9,67679 |
| 69Q2d | 221 | 6,20070 |
| 6BdHt | 212 | 5,30441 |
| 6Be41 | 211 | 5,30441 |
| 6JOwS | 195 | 8,63085 |
| 6JVyq | 210 | 5,97505 |
| 6K4TZ | 201 | 9,04564 |
| 6OzQ8 | 205 | 6,91875 |
| 6V4KN | 204 | 8,96035 |
| 6bhDO | 197 | 7,29787 |
| 6prRt | 273 | 8,11729 |
| 722s3 | 208 | 9,12197 |
| 722tC | 204 | 7,63702 |
| 722tb | 211 | 9,63378 |
| 722vU | 210 | 9,37591 |
| 722wY | 212 | 9,02920 |
| 72ub5 | 190 | 9,34761 |
| 76q8O | 204 | 8,24707 |
| 7Fp1V | 188 | 9,25697 |
| 7K9P | 204 | 6,31682 |
| 7V9tV | 211 | 9,32169 |
| 7WYoL | 204 | 8,85056 |
| 7Xu9T | 204 | 8,41424 |
| 7hhaM | 212 | 9,20816 |
| 7hhcG | 209 | 9,01747 |
| 7nIrv | 163 | 7,01657 |
| 7nIte | 210 | 9,59884 |
| 7p0cM | 203 | 8,82168 |
| 7wFoE | 214 | 9,09470 |
| 7wFwK | 197 | 9,15536 |
| 7wFxi | 197 | 9,32124 |
| 7wQIP | 197 | 9,32156 |
| 7wQJ3 | 197 | 9,32156 |
| 86Otc | 197 | 7,17816 |
| 8AWc | 195 | 9,13396 |
| 8CwJ1 | 211 | 6,44323 |
| 8Fi9l | 211 | 6,92273 |
| 8Fj7G | 211 | 7,83512 |
| 8aJlS | 221 | 6,30006 |
| 8iVbH | 221 | 6,80746 |
| 8jvIn | 221 | 6,71470 |
| 8wnUE | 211 | 7,88869 |
| 8xlvu | 208 | 7,88869 |
| 8xmp1 | 211 | 8,68861 |
| f7tX | 193 | 8,47825 |
| f7y9 | 204 | 6,43045 |
| gFoB | 213 | 6,44448 |
| lCUi | 211 | 9,29539 |
| lDTp | 205 | 9,45031 |
| n3Z7 | 204 | 6,12459 |
| nagT | 204 | 6,12459 |
| ogFo | 205 | 7,58666 |
| q5r0 | 204 | 6,91875 |
| sZU8 | 190 | 9,55062 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_20898
6VHSS
|
327 | 33,3% | 183 | 2.155E-42 |
| 2 |
phalp2_33062
4ARSx
|
1 | 30,8% | 185 | 2.409E-40 |
| 3 |
phalp2_26096
7w9ed
|
2 | 31,1% | 180 | 9.410E-32 |
| 4 |
phalp2_6029
4Ttjs
|
1 | 32,7% | 186 | 6.175E-31 |
| 5 |
phalp2_10635
2uHA2
|
48 | 27,2% | 202 | 7.578E-30 |
| 6 |
phalp2_39384
4Ji2N
|
17 | 27,9% | 193 | 8.315E-28 |
| 7 |
phalp2_28188
8EnbV
|
1 | 28,8% | 184 | 2.908E-27 |
| 8 |
phalp2_40033
26aY8
|
2 | 21,5% | 186 | 7.435E-27 |
| 9 |
phalp2_4098
1twmT
|
2 | 25,4% | 185 | 1.017E-26 |
| 10 |
phalp2_29328
OWz8
|
5 | 30,8% | 185 | 6.640E-26 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(t4Qh)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50