Protein

Protein accession
1sZ7c [EnVhog]
Representative
8wEtz
Source
EnVhog (cluster: phalp2_2807)
Protein name
1sZ7c
Lysin probability
92%
PhaLP type
endolysin
Probability: 98% (predicted by ML model)
Protein sequence
MNYYIKKYLLLLLYYIREYREEVKTGLIAFVITILTYSFLNYSYKTVEEIEPVEIEIPEVDQDFIDDIRGALEEPDIISDTNEQFIASLDTCIDYVYLSVSPERQLPRKLILAQAILESAWGKSRFANEGNNLFGIRTFDKSTDYLLPITWDPNKWPGWGVKVYESKCASVRDYVRIINEVWAYEELREARKENPDITAVELAMYLDKFSTNPNYENLVVRIIETKL
Physico‐chemical
properties
protein length:227 AA
molecular weight:26675,1 Da
isoelectric point:4,61
hydropathy:-0,22
Representative Protein Details
Accession
8wEtz
Protein name
8wEtz
Sequence length
219 AA
Molecular weight
25216,44100 Da
Isoelectric point
4,64331
Sequence
mkylttiltifglylivlgcspkeiectddgcpefdvdeitippvlddqeirgeldiqklvvpvistetkddfvyslnkcidhiystlpseqhiprelviaqaaietgwgksrfanegnnlfgirtfnkddewllpitwdqnkwigwgvkvyadrcesvkdyvrilnevwayeefrevrenggtvfeladtltkyaskptytilvkniirhnilgvyel
Other Proteins in cluster: phalp2_2807
Total (incl. this protein): 388 Avg length: 212,4 Avg pI: 5,89

Protein ID Length (AA) pI
8wEtz 219 4,64331
1093B 201 4,73863
10aL7 227 4,88073
10b0x 157 4,96087
10kA6 227 4,78672
1113X 247 4,73733
17Avc 219 4,36594
1A1g9 228 4,78240
1AXa 194 5,87587
1DbG 210 5,97266
1EP5l 202 7,77748
1EPv5 210 4,97792
1Fo1J 203 5,13008
1FoQ7 194 8,39567
1HmgW 194 6,07901
1OJnv 186 8,32392
1ORno 197 6,59778
1PTxM 193 7,84260
1REI 281 7,51664
1RrPm 239 5,60747
1RzVF 228 4,71925
1S65V 186 8,31534
1SHC6 191 5,10911
1SPm4 239 5,21682
1STX6 220 4,77257
1Sr3E 227 4,71612
1SxLB 200 7,00276
1SyP4 223 5,02243
1T1fq 216 4,71072
1TcJg 190 6,83366
1Tjxa 219 4,47365
1U5Vf 199 6,30847
1UHl6 196 6,95967
1UUsg 213 4,83532
1UVpt 223 4,75409
1UwZV 207 6,65621
1UwfL 193 9,31525
1V6it 185 8,31721
1VBbt 213 4,57863
1VF8V 227 4,82383
1VSDf 213 5,00828
1VXH3 223 4,96576
1VdQ4 222 5,07086
1VdzK 215 4,67043
1Vx5C 213 4,62353
1Vy65 213 5,08302
1Vzlu 204 7,00941
1Wdmu 222 4,98656
1aoza 210 5,09871
1feUh 228 4,85021
1ftis 146 8,46368
1gc1N 239 5,11491
1rZnw 207 5,79931
1s0SH 209 6,60608
1s6jv 193 9,30119
1saa3 213 4,91631
1sb2a 238 5,12701
1siqs 207 6,65621
1t6CT 193 9,30119
1t8YC 200 8,63807
1tBCO 206 6,31120
1u7GS 227 4,56215
1ug7X 193 9,31525
1uxm2 238 5,15702
1vIQx 227 4,81332
1vX0s 213 4,69669
1vgkz 223 5,20323
1vqHl 193 9,30119
1vxe2 239 5,22654
1wDyw 227 4,72169
1wEDx 193 9,20539
1wMVV 227 4,74346
1wcoL 227 4,70157
1whxJ 240 5,11292
1x3Mr 193 8,98207
1x4nl 209 5,93163
1xm3d 200 8,30451
1yFNu 239 4,95741
1yPbS 223 5,02215
1yqUf 239 4,70919
1zTza 228 4,74011
21kX 213 4,87766
22ZBD 207 6,17495
22tMQ 193 8,38535
23ltt 236 4,80599
25Xhu 205 6,58016
2654w 210 5,62021
26Nct 206 6,59727
26ltt 194 6,43323
26pfF 197 6,30625
26zlR 207 8,39399
276ln 203 7,77014
277VW 197 5,70114
28j98 202 8,36511
2A1tZ 215 4,76751
2As3G 227 4,79689
2FXQE 222 4,91966
2Fcuk 192 8,86597
2GHJb 211 9,36392
2HHHV 211 9,15208
2Jz8r 186 6,89886
2KRlo 207 6,06821
2MVGR 202 5,68705
2N9Cm 200 6,29557
2Ouq1 189 7,68312
2PjLD 183 6,99236
2Po85 213 9,55159
2RHll 189 8,83580
2TBR1 194 8,86197
2TFsH 185 8,84708
2TJqC 228 4,99486
2TlVz 200 8,89498
2VJfq 214 9,33046
2XNae 213 9,34677
2Z14S 176 4,68719
2dM4M 193 6,42914
2gYD2 207 6,14261
2htlb 202 5,97181
2kef7 220 5,30446
2knlw 195 8,80807
2q16I 240 4,87289
2q4mU 196 6,95967
2q5c2 206 4,80610
2vEQ9 211 9,24891
2wXmw 213 5,11184
2yS0A 193 8,81394
2yTFG 238 5,05943
2yZS8 209 8,26525
2yiJh 206 7,69159
2yqln 210 5,24393
2z2ux 217 5,09700
2z8Zi 214 4,75756
2z8ys 236 4,84634
2zPjv 206 8,36447
2zTdR 207 5,52727
2zThB 208 5,31640
2zad7 241 5,99671
2zfUd 239 4,77154
2zh4O 216 4,95411
31iri 221 4,77592
31jxw 216 5,14156
32C58 227 4,73295
32C5R 222 4,75421
32DNj 219 6,11783
32HPo 227 4,79689
32HcL 248 5,59457
32J4m 213 5,96823
32JA7 216 5,16834
338Rp 216 4,95411
33M0c 187 9,40209
33N2a 227 4,85601
33g2i 211 5,39120
34Yz8 221 4,80570
34Z6b 230 4,58335
34lJ0 227 4,79689
355el 221 4,94860
3690t 227 4,43983
36t63 193 7,84247
39G7J 227 4,79689
39LIG 216 5,00424
3BKcO 207 6,17399
3Bo1d 216 5,17948
3C3xg 244 4,99702
3CYQZ 218 4,95991
3CZ8f 210 4,74091
3Ca0f 288 4,91029
3D4jb 212 4,79757
3DtP9 208 5,19943
3F5mJ 215 5,02953
3FVUD 214 4,63666
3FmYf 207 6,17399
3GEzh 177 4,66122
3GUls 217 4,52833
3Hq4J 239 5,10155
3J2AF 203 7,67181
3Javl 214 4,83117
3KAVQ 209 5,21068
3KlZw 219 4,45540
3KwLb 239 4,94217
3M3cf 206 5,30179
3UT9k 208 5,11292
3Un7z 228 4,84043
3VwtO 185 7,65317
3X0J1 239 5,50863
3Z6vz 224 6,17137
3ZmVN 236 4,90602
3cFZD 216 5,08319
3cgrC 242 5,31532
3crL5 216 4,90540
3jbAa 216 5,07211
3jhxB 216 5,08319
3oKBm 226 4,65559
3oKbL 215 4,74534
3oyuY 211 4,84373
3rBsP 207 6,17399
3rH05 238 5,61378
3rJxl 239 5,07535
3xg8F 193 8,84714
42D9t 206 6,30779
42u1r 217 5,00021
433Ro 204 7,67243
435Tm 210 6,16728
43bb3 186 8,31721
43i6j 217 5,13844
44Un8 239 5,75616
48qyJ 185 7,70068
4H3W 194 8,98910
4ND9 239 4,72295
4RW3D 240 4,91176
4S2TU 213 4,86351
4U5pI 185 8,90491
4UXlU 185 8,98207
4WXsm 186 7,72205
4WbbV 196 8,35841
4rYwd 213 9,24872
4t7GZ 207 6,17399
4t9kk 222 5,18709
4taWj 195 7,66806
4v4aX 213 4,73096
4v5W3 200 6,29557
4wwSJ 239 4,71232
4xcuW 204 4,43869
4xetp 235 4,96264
5A4cy 185 6,90300
5AjdU 186 6,43732
5cJ3 239 4,66321
5oCNM 177 5,31435
5oX9T 222 4,96906
5p08F 213 4,83776
5pSX3 177 5,31435
5qaf4 208 5,03829
5qqbl 210 4,83776
5qz3V 214 4,69453
5rSKi 185 7,67550
5sXVl 200 7,18976
5sXfS 196 8,66038
5yMU4 213 5,15475
6AU6y 230 4,77035
6CurJ 193 8,86184
6EaiZ 230 4,64797
6JsY9 185 8,31721
6N7uA 230 4,60546
6NY4T 202 4,70345
6O1ws 185 7,67914
6PfEb 209 5,34556
6Vp32 185 8,31728
7EBGJ 193 8,36427
7EJ5V 194 6,07901
7EV0H 197 8,30677
7Ef82 189 7,68312
7ExYm 222 5,33794
7FkEl 214 9,43484
7GOfS 200 6,29557
7SnhD 219 4,64331
7VGtI 220 4,97361
7WOhB 185 8,31908
7XhY7 185 7,66908
7rrZX 220 5,38023
82PNZ 204 7,69591
83RPW 208 5,34130
83lA1 214 4,78013
83tXX 177 6,30665
89bsm 210 4,99015
8A6RE 217 4,51611
8ADVk 239 5,60747
8AKyi 214 4,78013
8ANoP 230 4,60546
8AZb0 245 5,88172
8BAOX 203 7,67181
8BLMj 177 6,82485
8BZIl 207 6,17399
8Bzpd 217 4,52833
8C1fq 228 4,87795
8C7Zz 220 4,70749
8CDVF 213 4,73096
8CDdF 236 4,84634
8CFEy 210 5,54467
8CG6a 185 8,31728
8CJMp 212 4,72175
8CSMR 214 4,60949
8Cdz3 150 5,38518
8Cr9p 230 4,70447
8DH7L 219 4,47365
8DKEH 215 4,80570
8DQMc 196 6,09078
8Dflu 210 5,24393
8DfpB 216 4,92359
8Dhox 230 4,64797
8E38v 220 5,46060
8ENfS 177 6,30665
8EZb1 212 4,61779
8EtHf 209 4,82349
8F21G 222 4,99844
8FJTc 230 4,62336
8FZQO 212 4,63013
8Fm5x 227 4,79689
8G0QY 215 5,02953
8GHLg 216 5,14156
8GaIE 207 5,34550
8GfkW 216 5,08319
8GrBn 207 7,62111
8J4ZY 210 6,62182
8aHJw 213 4,57727
8avQa 196 6,95967
8ayeY 222 4,98656
8azZw 214 5,13383
8bVte 219 5,10655
8bh7p 202 8,62711
8c6Fm 215 5,02953
8cB8S 239 5,00055
8cHkj 239 5,07654
8cezs 213 4,88710
8dtQu 211 4,72971
8gQIY 206 5,30179
8geFh 231 4,86470
8gopY 196 6,43062
8guhs 177 5,94140
8hEZB 193 8,99419
8hHxD 214 4,86248
8huTy 218 5,06841
8hxhx 196 6,95967
8iadS 193 6,29454
8if99 222 5,09479
8ig5n 239 4,77154
8ih1q 209 6,83503
8jWPJ 220 5,58929
8kMPz 214 5,60980
8unmT 219 4,99708
8v8Sc 209 4,82349
8vH9k 240 4,96519
8vmJm 214 4,60949
8vyOR 213 4,55635
8w7wM 213 5,96823
8w8jA 222 4,91966
8wArM 220 5,30446
8wJ9b 227 4,88073
8wLUb 177 6,30665
8wMUs 211 4,84373
8wXtP 215 4,74534
8wZAr 218 4,95991
8ws7R 220 5,30446
8x7HK 242 5,31532
8xNm5 214 4,83117
8xS9t 235 5,00254
8xX8E 218 5,13514
8xg8G 213 4,55635
8xoC8 177 6,82650
8y5Df 213 5,01964
8y9V3 213 5,26138
8yPoE 230 4,64797
8yXis 214 4,63666
8yb5o 239 5,10155
8ycTk 206 5,30179
8yl4B 196 6,95967
8ypKR 203 5,12747
8ywRY 227 4,87073
8yz9M 240 4,80224
8z3yn 239 5,07535
8z6KW 208 5,34130
8zWiL 214 4,55635
8zms5 239 4,91176
8zsdj 214 4,77217
C5wF 200 7,86974
DdiS 194 9,25284
QVIl 212 9,29887
QfRt 168 7,88895
TtvL 227 4,93143
VTbr 227 4,75034
VhMo 235 4,94598
XdKB 214 4,78013
Xime 196 6,95967
Ym2I 240 4,83617
g75f 235 4,84771
gJLE 206 6,22463
gUP8 235 4,84771
ijyc 202 5,97175
lsCQ 222 4,99907
phMR 252 4,71084
pqec 206 4,54515
pylZ 202 5,97181
r997 210 5,96147
rCbS 235 4,84771
rRn1 222 4,76097
rbgF 239 5,36204
szIV 219 7,64725
zKoX 190 5,72246
M1IDP9 210 6,62182
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_17928
YxWk
140 39,2% 163 2.006E-72
2 phalp2_27854
8z2UL
887 48,7% 156 7.593E-57
3 phalp2_9899
2Cydi
49 54,6% 139 4.079E-54
4 phalp2_7458
4PhIq
10 49,0% 157 9.472E-50
5 phalp2_34258
3dxLm
725 41,8% 153 2.695E-47
6 phalp2_11429
8zF3P
9 32,4% 154 3.860E-28
7 phalp2_4384
2huub
3 30,0% 153 1.578E-15
8 phalp2_24548
7J4ML
47 25,6% 156 5.795E-12
9 phalp2_5784
7N5g9
18 27,3% 150 7.838E-09
10 phalp2_32846
31z3H
398 27,9% 136 4.120E-05

Domains

Domains
Disordered region
GLUCO
Representative sequence (used for alignment): 8wEtz (219 AA)
Member sequence: 1sZ7c (227 AA)
1 219 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01832

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (8wEtz) rather than this protein.
PDB ID
8wEtz
Method AlphaFoldv2
Resolution 83.44
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50