Protein

Protein accession
1rELs [EnVhog]
Representative
XBT4
Source
EnVhog (cluster: phalp2_27983)
Protein name
1rELs
Lysin probability
98%
PhaLP type
endolysin
Probability: 57% (predicted by ML model)
Protein sequence
MPTDQFIDFLKYVENGSKIGWNEEKQLWFPHHSPEGGNDTIAYGHKLLDSEVEMANNGLTDDEVEQLLIEDLHTAESGARNILLTHFNDNFDDLSQNGQEMLIDFAYNLGSYGLKSFPKFVGAVCSNNMEVMCAEYKRYYTDGFGAKKELKQRNEEFYKLFLA
Physico‐chemical
properties
protein length:163 AA
molecular weight:18710,6 Da
isoelectric point:4,61
hydropathy:-0,57
Representative Protein Details
Accession
XBT4
Protein name
XBT4
Sequence length
176 AA
Molecular weight
20215,83510 Da
Isoelectric point
9,61070
Sequence
MFENIDIPPAHIQSNTRHEFSSKLINYIKNTENGVKKGYKNGKWYPYASIEGGSPTIGYGHKLTGNEVSQFRNGISDKDVETLLVQDLKVAKNKVYNDIKHMFNVNIPTLDQHKEEMLIDFAYNLGTIKQFPKFVRAVLVGDWKSASKQYKRTATDKHGKKIELARNKSFFNTFLK
Other Proteins in cluster: phalp2_27983
Total (incl. this protein): 216 Avg length: 173,3 Avg pI: 6,16

Protein ID Length (AA) pI
XBT4 176 9,61070
10sRQ 209 9,47784
12nIi 163 4,62387
14IDL 209 9,17032
15LhA 209 9,40363
15npz 188 9,80650
17kQh 160 4,62683
1A0xj 213 4,93200
1MFXv 182 9,66911
1Yugq 185 9,73816
1alEZ 193 5,30191
1lCGl 182 9,06292
1qUBx 169 4,92228
1zhiN 273 9,71198
20vjb 191 9,09973
27BAW 148 8,72472
29jiv 160 4,84668
2AJri 158 4,74574
2AKUF 163 4,61603
2AMnK 163 4,72209
2CJh7 161 8,35679
2DSoZ 203 9,37591
2EBvF 201 9,60033
2Eh1u 204 9,08161
2FC1i 189 9,72333
2Fqnd 183 9,31789
2GRwM 197 9,49782
2Mbf0 169 8,90394
2OWDj 202 6,01023
2XzRU 163 4,51588
2bBxh 204 9,52103
2bFkL 205 9,06298
2jSvC 161 4,84725
2nshk 179 6,75477
2p5YA 188 9,06311
2pHC9 200 7,83421
2qzF 198 5,15401
2xTqa 163 4,62683
2xzAZ 160 4,77956
2yFeC 163 4,68185
2yug5 160 4,66548
33ceR 198 6,84776
34Bvd 186 5,72786
34Hik 189 6,59664
383iU 179 7,85291
3CHGG 164 4,36838
3EBtx 160 4,84577
3EEp0 162 5,93890
3ERJu 163 4,50394
3EY7D 163 4,57334
3En3W 163 4,53288
3FZZI 162 5,93890
3FbyS 162 5,93890
3FrTZ 163 4,62683
3H57y 162 5,50397
3I091 163 4,52418
3JMpq 160 5,41632
3Jjhs 160 4,54629
3KfCc 163 4,42005
3KgBb 158 4,60114
3Kiem 160 4,80752
3KirV 161 4,49047
3KlxW 163 4,38095
3L0XW 160 4,77586
3P1XY 224 4,56056
3P6VC 182 9,67646
3R0Rf 171 6,91295
3TWZC 185 9,58382
3aAbq 184 9,32118
3cAI3 163 4,51588
3jbVm 163 4,56914
3jtOr 163 4,51588
3jvag 163 4,51588
3nnqq 163 6,21520
3xeg1 160 4,84083
3zmcK 190 9,22228
43jq2 212 4,65008
44PbF 235 9,42923
47jMS 189 9,61251
47mrL 195 9,33620
4AKR5 185 9,25897
4AWL1 220 9,42226
4HVgr 191 9,36276
4Hk5Q 221 9,70657
4IKLO 186 9,48673
4KaSC 182 9,09741
4UMdL 163 4,51111
4UpN9 163 5,09706
4VPr 160 4,74574
4Wr3P 177 6,13119
4cZMf 191 9,13519
4d1Wo 191 9,38822
4d3C9 197 9,41891
4fb2h 176 9,35992
4oHhr 245 9,37372
54Hp 160 5,00651
5X2b 160 4,81622
5f47p 241 9,72978
5gc9h 232 9,42168
5sdHi 160 4,82190
6XIAQ 184 9,29913
7DwGD 162 5,93890
7Efil 163 4,48081
7FBP6 195 9,44160
7GV4b 158 4,74574
7WaM6 160 4,78416
7WmFx 160 4,85174
7Y2WX 173 5,78635
8165a 163 4,52907
81FRC 162 6,19644
82c7v 193 8,79924
83kjg 161 4,70908
83kzZ 163 4,52418
85BGK 164 4,31200
86I9U 180 9,28346
8963A 160 4,62683
89ZU6 158 4,80258
8A2sh 160 4,78416
8A9Kl 158 4,65428
8AJLK 161 4,70908
8ALYr 160 4,80752
8Acd9 163 4,50394
8Ak3q 160 5,04028
8AyQF 163 4,52418
8B9LF 160 4,67173
8BF0G 163 4,52418
8BHEN 161 5,14810
8BV78 162 5,50397
8BYWT 158 4,89426
8C9IB 160 4,77188
8CCKZ 160 4,84668
8Ch7U 153 4,75921
8CjDU 160 4,65428
8CsWB 212 4,53975
8CtVC 213 5,04460
8DU8e 160 4,77154
8DWDj 163 4,61040
8Dfvc 163 4,72715
8Dm52 160 4,62683
8Dv4E 163 4,42005
8E4qf 163 4,74096
8EF08 162 6,19644
8EGeg 158 4,89619
8EUUf 163 4,61040
8EVIg 160 4,76324
8EWvq 161 8,35679
8EeDW 157 6,57294
8EfXN 161 4,52111
8FKH9 158 4,73647
8FKmH 163 4,52998
8FPjJ 160 4,70908
8Fy8Y 160 4,92512
8G0yB 161 4,52111
8GNdq 162 5,70973
8GeM3 161 4,84725
8GkoK 160 4,77586
8Gmhd 160 4,77615
8GoxN 163 4,61626
8Gsps 160 4,65929
8GuPg 158 5,01066
8gGo8 161 5,14810
8gLdE 160 4,82190
8jhIk 163 5,12491
8l2pV 158 4,89619
8nLGQ 160 4,65428
8nNgk 162 5,93890
8pca 161 4,52111
8tIIp 160 4,84668
8us96 160 4,78416
8veCk 161 4,90904
8vfp6 162 5,94339
8w84B 160 4,84668
8w96g 163 4,52418
8wCus 162 5,93890
8wIE1 162 6,95939
8wKip 161 4,90904
8wVVb 161 4,89613
8xECV 160 4,95019
8xOF6 160 5,41632
8xZ7x 163 4,48081
8xdXk 160 4,80258
8xpMw 164 4,58460
8yJtX 171 4,65428
8yKwJ 158 4,75023
8yNnV 163 4,62683
8yfFl 161 4,78416
8yhDh 162 4,93780
8z8yG 162 5,93884
8zJwE 160 4,78416
8zRP5 160 5,41632
8zhqM 160 4,81088
8zhvM 163 5,18323
8zmZc 120 4,73465
8zr1H 118 4,59165
8zx3x 169 4,40647
8zyPZ 162 5,93890
FlgZ 199 9,59014
HSR5 155 4,88306
HVUd 162 4,79837
JxIB 202 9,62469
OWtF 232 9,66241
OWud 232 9,66222
VlHb 161 4,90835
XASa 206 9,41872
XzUC 201 6,58806
YNmF 163 4,74096
YQzW 161 8,35679
YTBd 160 5,17737
YjaY 182 9,59098
Zc6a 161 8,35679
Zh3e 186 7,10876
cOGJ 204 9,41620
cVhw 204 8,62415
dSdJ 221 5,72769
s4xF 160 4,75892
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_16215
4K8FW
1 45,1% 175 5.214E-59
2 phalp2_13977
ju9K
1 34,8% 155 7.432E-40
3 phalp2_37151
1vexR
13 33,9% 156 4.910E-39
4 phalp2_7888
8DPLM
9 35,4% 141 1.276E-35
5 phalp2_9437
pkYK
27 35,8% 134 4.052E-34
6 phalp2_40086
7UWnF
13 32,7% 162 1.950E-33
7 phalp2_20082
1M8nQ
16 25,4% 165 3.656E-33
8 phalp2_28507
27SXS
1 36,4% 170 2.171E-31
9 phalp2_2049
2CmXK
1 27,2% 191 4.511E-29
10 phalp2_38422
17tKX
93 32,7% 168 1.945E-27

Domains

Domains
Representative sequence (used for alignment): XBT4 (176 AA)
Member sequence: 1rELs (163 AA)
1 176 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF00959

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (XBT4) rather than this protein.
PDB ID
XBT4
Method AlphaFoldv2
Resolution 91.68
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50