Protein
- Protein accession
- 1qUgh [EnVhog]
- Representative
- 83KqQ
- Source
- EnVhog (cluster: phalp2_38675)
- Protein name
- 1qUgh
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
VATKTKYKINKRYTAHKGNYGSGTNARKYIVVHNTGNTASALNEAKYAHNDQHASSYHYVLDGSGTIYRTLPPRRIAWAVGTAGFSGAKRLIGNDESISIEVKSNGTKFTDAEIAELRWLVKRLMRRYGIPAKNVVRHYDCHTGRKDCPAYYCVKNKAGNFARWNALKKKITE
- Physico‐chemical
properties -
protein length: 173 AA molecular weight: 19454,9 Da isoelectric point: 10,01 hydropathy: -0,69
Representative Protein Details
- Accession
- 83KqQ
- Protein name
- 83KqQ
- Sequence length
- 151 AA
- Molecular weight
- 17036,85470 Da
- Isoelectric point
- 6,51155
- Sequence
-
MSYKFKEIWCNKGNFTESNRKSSEIDTLVIHYTGNNGDTAENNGNYFKNNVVETSAHYFVDDTTVVRSVADKNIAWHAGDWDINCRSIGIEIAGSTTECTGKTLENVILLAQRLMKKYNISKERVIRHYDANGKICPGFWCGSSAVSFHIE
Other Proteins in cluster: phalp2_38675
| Total (incl. this protein): 128 | Avg length: 198,5 | Avg pI: 9,87 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 83KqQ | 151 | 6,51155 |
| 13wdo | 163 | 9,70670 |
| 1jHMe | 166 | 9,96515 |
| 1jT3U | 231 | 10,31141 |
| 1kc0o | 137 | 9,20172 |
| 21f06 | 248 | 9,80269 |
| 21phn | 242 | 10,05347 |
| 21w7t | 245 | 9,59839 |
| 21wa8 | 250 | 9,45108 |
| 235rf | 246 | 9,51490 |
| 23GSH | 270 | 9,34619 |
| 23KDa | 262 | 9,73036 |
| 23Lw1 | 257 | 9,85807 |
| 23Nm7 | 231 | 9,84872 |
| 23c3Q | 240 | 10,19582 |
| 23dVB | 257 | 9,75885 |
| 23wbm | 251 | 9,83267 |
| 24KJP | 245 | 9,67459 |
| 24q03 | 169 | 9,72804 |
| 2mc3G | 234 | 10,03149 |
| 3A4Gl | 173 | 9,98050 |
| 3A4U9 | 173 | 10,06334 |
| 3GQ9c | 166 | 10,14128 |
| 3LQiD | 166 | 10,18299 |
| 3TRMC | 237 | 10,18260 |
| 3VGxp | 171 | 9,67111 |
| 3WDHm | 237 | 10,00525 |
| 3WEqW | 170 | 9,73171 |
| 3WH4u | 172 | 9,76233 |
| 3Wyh8 | 172 | 9,96232 |
| 3ZQhS | 257 | 10,07481 |
| 3gLVx | 259 | 9,72243 |
| 3j0Bl | 181 | 9,13847 |
| 3kTG7 | 243 | 9,93040 |
| 3l0TC | 234 | 9,92376 |
| 3mtXx | 170 | 9,92757 |
| 3rmdM | 234 | 9,94156 |
| 3tQkJ | 166 | 10,26132 |
| 3taaG | 234 | 9,97779 |
| 3ymfP | 166 | 9,83435 |
| 40cHd | 239 | 9,91197 |
| 41bM4 | 196 | 9,81778 |
| 41fBM | 177 | 9,83654 |
| 41i9Y | 194 | 9,78567 |
| 41iFH | 173 | 9,61554 |
| 4kkcu | 236 | 9,92518 |
| 5KHti | 230 | 9,93866 |
| 5KOLr | 230 | 10,07526 |
| 5Labl | 166 | 10,01827 |
| 5MTCB | 166 | 10,12768 |
| 5OGR2 | 166 | 10,15153 |
| 5QptN | 166 | 10,07746 |
| 5RP6w | 234 | 9,94027 |
| 5RqYn | 166 | 10,18299 |
| 5SJ1e | 230 | 10,03633 |
| 5SMcn | 230 | 10,03394 |
| 5T0oX | 166 | 10,12768 |
| 5USnc | 230 | 9,90043 |
| 5UstP | 230 | 10,03504 |
| 5XHMv | 166 | 10,04748 |
| 5YH9H | 189 | 9,79618 |
| 5Z19f | 166 | 9,99681 |
| 5ZX79 | 230 | 9,82371 |
| 604V2 | 230 | 10,05412 |
| 60dfL | 166 | 10,20485 |
| 63dbt | 194 | 9,82061 |
| 649FM | 166 | 10,12839 |
| 64npU | 166 | 10,01879 |
| 66Qqm | 230 | 9,89591 |
| 67f1I | 230 | 10,11678 |
| 684nA | 174 | 9,87619 |
| 68tiT | 168 | 10,01769 |
| 69SSq | 230 | 9,86226 |
| 6YjRA | 166 | 10,16068 |
| 6aXqz | 230 | 9,99487 |
| 6bJjN | 230 | 10,03394 |
| 6bSUi | 234 | 9,97643 |
| 6eKaY | 230 | 10,05618 |
| 6f8DJ | 166 | 9,99249 |
| 6frzw | 166 | 10,04148 |
| 6hQFB | 234 | 9,95987 |
| 6hh7k | 230 | 9,99835 |
| 6k57J | 189 | 9,81900 |
| 6kAi8 | 166 | 10,07391 |
| 6kntS | 230 | 9,86226 |
| 6lcZg | 166 | 10,09699 |
| 6lkOz | 194 | 9,93569 |
| 6sgDf | 196 | 9,95645 |
| 6v6xG | 239 | 10,16004 |
| 6vOgv | 166 | 10,18299 |
| 71tVa | 238 | 10,15624 |
| 7VqsI | 163 | 10,02717 |
| 7Y6Ml | 234 | 9,99597 |
| 7Y6ww | 174 | 9,94078 |
| 7YxCh | 166 | 10,19356 |
| 7t17I | 194 | 9,89939 |
| 7tRhb | 196 | 9,75769 |
| 7ypbO | 194 | 9,93859 |
| 82GAH | 167 | 9,80031 |
| 82GWR | 167 | 9,76298 |
| 84m8L | 166 | 10,07391 |
| 84pRx | 243 | 9,96547 |
| 85Oki | 164 | 9,75782 |
| 86elI | 172 | 9,82364 |
| 887d1 | 162 | 9,69722 |
| 887ma | 173 | 9,75744 |
| 888Wq | 160 | 10,09854 |
| 889Hb | 163 | 10,00777 |
| 8br9w | 166 | 9,62012 |
| 8cCeN | 230 | 9,90017 |
| 8dlzW | 230 | 9,90043 |
| 8fBnW | 166 | 10,12071 |
| 8fHuJ | 166 | 10,07681 |
| 8lUY2 | 159 | 9,88199 |
| 8lUle | 166 | 10,02008 |
| 8mp3C | 173 | 9,73655 |
| 8mpyi | 164 | 9,74486 |
| 8pV8H | 164 | 9,72875 |
| 8pZoO | 182 | 9,86355 |
| 8qtm4 | 173 | 9,72765 |
| 8r5BO | 166 | 10,04683 |
| EFEr | 189 | 9,80469 |
| EJkz | 236 | 9,87238 |
| JO77 | 234 | 9,92376 |
| oTMg | 194 | 9,89469 |
| oeXh | 166 | 9,63391 |
| A0A8S5LF58 | 171 | 7,61758 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_29669
8sfID
|
1005 | 45,7% | 153 | 8.321E-49 |
| 2 |
phalp2_24299
3nIle
|
36 | 47,0% | 134 | 5.713E-45 |
| 3 |
phalp2_23405
676qm
|
129 | 29,6% | 135 | 2.517E-43 |
| 4 |
phalp2_1605
81mMl
|
270 | 41,6% | 149 | 1.382E-40 |
| 5 |
phalp2_15490
7YA8O
|
2 | 39,6% | 159 | 1.143E-38 |
| 6 |
phalp2_34832
3TNM2
|
9 | 30,2% | 152 | 1.039E-37 |
| 7 |
phalp2_3793
5X3JD
|
59 | 43,0% | 137 | 6.262E-36 |
| 8 |
phalp2_38069
6uYUB
|
10 | 47,2% | 110 | 7.997E-32 |
| 9 |
phalp2_14283
3qOze
|
23 | 41,5% | 118 | 6.580E-30 |
| 10 |
phalp2_9579
1njYk
|
79 | 28,3% | 155 | 3.178E-29 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(83KqQ)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50