Protein

Protein accession
1qC6W [EnVhog]
Representative
3yVVm
Source
EnVhog (cluster: phalp2_16018)
Protein name
1qC6W
Lysin probability
99%
PhaLP type
endolysin
Probability: 98% (predicted by ML model)
Protein sequence
MTGAKKLLSVARIELGTKELPAGSNCVKYNAAYYGREVSGDSYPWCCVFLWWCFQKAGLGRLFYDGERTASCGVLADWAKQIGRFATKDYQIGDLVFLRFSGTAIQHIGVVEQINADGNLITIEGNTGASSDANGGEVQRRTRALRYAAGAFRPEYEEDNVTQENFNAMMEVWLQKRTELPPGDFSAQARSWAEGNGIIQGNTNGTFQYKSWCTREQMLVFLHRFLETIKK
Physico‐chemical
properties
protein length:231 AA
molecular weight:25884,9 Da
isoelectric point:7,56
hydropathy:-0,36
Representative Protein Details
Accession
3yVVm
Protein name
3yVVm
Sequence length
211 AA
Molecular weight
23100,77380 Da
Isoelectric point
5,33465
Sequence
MATVSELLDIARRQIGVKECPPNSNNVRYNTWYYGREVSGAAYPWCMVFVQWVFDQAGVKLPVRTASCGALMRAAKAAGQWVTGDYRPGDVVIYDFPGGAKTDHCGIVESVDGTYISAIEGNTSSASDADGGAVERRARKFSQIVGAVRPSYDKEVEEVRYNTVSECPAWARETVQKLVDREYLNGTGEGLDLSADMVRLLVILDRAGAFK
Other Proteins in cluster: phalp2_16018
Total (incl. this protein): 206 Avg length: 219,1 Avg pI: 7,16

Protein ID Length (AA) pI
3yVVm 211 5,33465
1176j 234 5,45270
118hu 235 5,66391
137lv 212 8,43138
139rW 236 5,79078
13B7B 231 6,04485
13DyM 231 6,04923
13czF 211 9,45057
19avp 244 5,74508
1HpFr 226 9,12564
1K1IO 168 9,45166
1MuGi 168 9,33568
1afA4 231 6,01455
1c6DY 231 8,27569
1c6PQ 203 8,20684
1cd2I 231 9,10933
1d8E7 227 6,88527
1dapW 216 8,52048
1dauE 237 8,12149
1eFuP 174 6,13534
1ekNN 220 7,77315
1f7nZ 230 6,62637
1f81e 231 8,99716
1jBnM 226 5,20846
1kw3a 243 7,57729
1lFh 258 5,99529
1nlWc 203 8,89601
1qF2Q 231 7,55949
1qvUl 231 5,82471
1qw8c 231 5,17925
1qxD1 230 8,27853
23PS4 199 9,47087
2RrPz 181 9,47964
2X60D 210 9,37217
2l3jy 205 4,92887
2nem4 225 5,83682
2qB21 175 9,37262
37mDR 194 9,42446
38OYp 217 6,22020
3B6Xs 224 6,75380
3I8zv 255 4,51173
3TMf3 196 9,53379
3WzZp 207 9,39300
3ZMlg 227 5,24501
3ZNfj 205 9,39100
3Zqo5 207 9,34722
3e2Gq 214 9,70567
3fPAQ 207 9,38281
3gPgL 209 9,58956
3gRDf 207 9,39860
3inbX 233 4,72482
3nB2E 220 6,83429
3nG3w 222 4,93348
3nzvc 221 8,87235
3uuSM 225 6,62830
3yLbj 209 7,52198
40kiZ 229 9,40737
45hq7 216 7,62833
4jamD 244 10,02646
4k3YO 218 9,42710
4k5dx 175 5,59378
4k7HB 204 9,62379
4kc0h 199 9,61580
4krlw 205 9,32956
4xC2X 242 6,34797
4xCva 227 5,67426
4xE18 188 7,54352
4xpRI 213 9,02604
56FEK 168 9,43174
5C3nB 170 9,49879
5HGGS 232 6,22128
5HGH6 232 6,52497
5HMy3 231 8,72981
5NCW9 207 4,89551
5NISL 225 5,07131
5OBT6 231 5,08473
5Oh7o 236 5,33976
5PLKH 205 4,80081
5Q8Wr 222 6,60102
5RQtP 207 5,11690
5SN5B 205 6,14938
5ScnT 236 5,78009
5Tn7B 178 9,09773
5TqI1 250 4,71209
5UHSL 206 5,10075
5VGS4 205 5,14770
5Wx4F 236 5,32828
5Ye4F 220 5,61100
5cCaz 168 9,43174
5e1BP 219 6,20889
5smW 200 9,39854
5uZCp 168 9,41304
5wZTJ 168 9,33568
5ys5D 169 9,51864
61LAR 207 4,99151
61hjF 205 5,74883
62ig2 207 4,99151
64uCp 232 5,09814
65VRn 207 5,45969
69zTJ 205 5,01544
6ayuK 250 4,71209
6bE8s 250 4,72187
6dn4l 236 6,16705
6hiJD 207 5,09388
6jO1U 205 5,14770
6lY6C 202 5,60878
6nyVw 236 5,78009
6pIVg 250 4,71209
6qf5 184 6,36190
6tO71 225 5,01317
71V6O 227 4,91000
71V7a 231 8,48702
71V87 233 4,87090
75Et9 243 8,56683
75Ete 231 4,75887
7DREY 257 4,69026
7DS3l 206 9,51336
7G6S2 238 8,57096
7JOca 246 5,72212
7M90L 205 5,14770
7UGH6 216 6,14631
7VZFO 198 9,15233
7WKx6 216 6,14631
7WMxQ 238 5,27929
7XTQB 236 5,78004
7Y3Tq 224 6,60363
7ZFzJ 209 7,51596
7lazh 242 9,72888
7xzCi 203 8,80130
7yjTv 243 9,43419
812Pz 211 5,17180
81Sim 237 9,43722
82tY1 203 8,96048
84IhD 240 8,16868
84oeF 226 5,35659
855Ri 207 8,89717
857Li 245 9,31196
859mp 220 8,22367
85pPY 223 5,74207
86aaf 224 6,17325
8cF0s 203 8,97324
8d8uL 226 5,47987
8dbdH 217 8,20948
8dlrA 178 5,19550
8ewOm 235 9,22383
8fapI 179 5,65124
8fauG 211 6,81411
8fj1U 206 5,45969
8jpR1 236 5,78009
8k1FW 220 5,10394
8kmgK 198 9,02030
8lTkT 220 5,24746
8lno8 224 5,02607
8lnvv 229 5,12230
8oC3l 227 8,56413
8omv9 238 4,89892
8pXpU 224 6,01012
8qS3k 228 6,33308
8r8fD 230 8,99942
8rFWb 220 8,63137
8rGRu 221 9,44567
8rQo4 228 6,83042
8se0c 207 5,06296
8se3h 202 5,60878
8syI1 229 9,28018
8tPBi 230 5,37250
8v7Hk 232 4,73903
9Ulh 215 7,71023
L4VD 176 9,33562
grY0 224 8,59668
m17Z 224 8,72194
mWEn 224 8,72194
n0VN 220 8,53853
n5EI 220 7,61139
n5xF 213 5,34761
n71n 238 8,50952
n87E 242 9,22190
nAdn 213 5,77037
nAeA 239 6,44102
naxk 228 8,50256
ndbw 238 9,08206
ndh6 250 9,58427
ndoC 298 5,20460
neoj 211 9,57357
nf3b 210 9,40660
nhK4 239 6,44113
niUQ 209 6,14398
njST 228 5,95345
nkbE 220 8,77842
nwuk 238 9,01663
nxsP 228 6,83042
o1eT 228 7,50510
o29d 225 8,42416
o862 224 5,69790
o8dA 219 5,94186
o9JX 228 7,65567
o9lg 238 7,60127
ohKa 241 6,21878
ohSV 227 6,16563
olzW 206 9,51387
onCf 213 9,13080
oqa9 224 8,10389
pLf6 237 5,69682
xshe 203 8,81220
A0A8S5MTJ0 224 4,86152
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_18705
oeYw
31 56,9% 151 1.035E-72
2 phalp2_15386
1Nzv3
2 51,9% 156 5.294E-63
3 phalp2_40071
41qFE
139 46,5% 159 6.566E-62
4 phalp2_24157
2dFjl
298 40,3% 156 8.488E-49
5 phalp2_4499
3nCxR
65 35,3% 212 1.591E-48
6 phalp2_33264
5Ekx7
97 38,7% 160 2.423E-46
7 phalp2_2684
7236j
6 35,4% 217 2.987E-45
8 phalp2_22287
7C3Cm
23 40,2% 199 6.894E-44
9 phalp2_7242
3OKiC
1 35,4% 155 3.311E-43
10 phalp2_1568
7XJtL
188 39,8% 168 1.162E-42

Domains

Domains
CHAP
Unannotated
Representative sequence (used for alignment): 3yVVm (211 AA)
Member sequence: 1qC6W (231 AA)
1 211 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF05257

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (3yVVm) rather than this protein.
PDB ID
3yVVm
Method AlphaFoldv2
Resolution 95.74
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50