Protein
- Protein accession
- 1oFBu [EnVhog]
- Representative
- 4MaUn
- Source
- EnVhog (cluster: phalp2_40555)
- Protein name
- 1oFBu
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
VVAGREETTMTDLWMPGAQKHPLGNTGVMDGGPSRATWHITSNSKDWTFKNELGWFNGGGAPVAPHILWDPFTGEIAQFFPADSRSLSLKNAGDTKTNRTGKYNIQIEIVFTEGETVNGKRYYTVAETPRKNLDKIVAWLRSLGIVDTFPGGAPTAFKRDDVSLSTWLSKGGHYGHNQVPGNSHVDPGPLGNLFPAAALPAPKPAPVYAPFPGDKYFVYGRTAKIVTEVGKALVKAGYKGYKLGPGPVFGPADRKGVIWFQKKQGWTDADADGHFGTETWKRLKVAVPK
- Physico‐chemical
properties -
protein length: 289 AA molecular weight: 31409,2 Da isoelectric point: 9,50 hydropathy: -0,45
Representative Protein Details
- Accession
- 4MaUn
- Protein name
- 4MaUn
- Sequence length
- 337 AA
- Molecular weight
- 37013,19880 Da
- Isoelectric point
- 6,71345
- Sequence
-
MATIYLRGANITAQWYADNYPGTTFPRLEKFLLHTTETGGWPGYSAGASAPNATYYPKFRQIRQHFGINRSARALRDPSSTAVRENRDNVFQLEIICYSDYRLAVERGGIWVGDLTDTHMRDIAAMILQCHRDWDLPIQSSVTWREGRKTYYNDVRLSGPQFDAYRGILGHVHASGNTHWDPGGFRYSKLKTALSWQLVNHPVYGGGVTIPDPTVPGGTLDPKDWFDMATLGELKQVVRDVLGEGGDATPYIDGKFQSRDTAIRRASVNSGNAVNAIKYQVLPELAAIRAMQVDIDALAAAIVGKLPNAGSASIDKETVKQGLIEVLTEGVGGDAPA
Other Proteins in cluster: phalp2_40555
| Total (incl. this protein): 147 | Avg length: 306,3 | Avg pI: 6,96 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 4MaUn | 337 | 6,71345 |
| 1IDjQ | 276 | 5,82505 |
| 1IbMg | 294 | 6,66246 |
| 1IfGt | 318 | 5,24456 |
| 1LQrh | 288 | 5,99324 |
| 1dvWX | 315 | 5,52784 |
| 1fP4H | 251 | 6,82519 |
| 1fvBR | 312 | 9,46823 |
| 1gMIA | 301 | 8,91084 |
| 1hRAs | 301 | 8,41088 |
| 1oOyI | 276 | 7,80823 |
| 2SIkU | 345 | 5,01635 |
| 3OQzW | 288 | 9,44928 |
| 3OR1Y | 274 | 9,36676 |
| 3T2OI | 314 | 6,00512 |
| 3dGyQ | 319 | 4,93376 |
| 3e57w | 319 | 5,05699 |
| 3eamm | 307 | 7,67312 |
| 3ebSe | 323 | 4,74670 |
| 3ezuJ | 318 | 8,97808 |
| 42uZo | 269 | 6,06150 |
| 4F4Ly | 284 | 6,35502 |
| 4HGip | 314 | 8,67572 |
| 4HHiM | 325 | 5,08234 |
| 4HII6 | 290 | 5,49186 |
| 4JmtB | 338 | 5,95305 |
| 4KDpl | 291 | 7,86213 |
| 4KxBq | 292 | 8,81716 |
| 4MAdH | 325 | 6,29613 |
| 4MZNJ | 318 | 8,86307 |
| 4MajL | 303 | 7,81784 |
| 4N6V9 | 336 | 7,09739 |
| 4NFGS | 303 | 6,75761 |
| 4Ojtc | 321 | 6,25993 |
| 4QxxV | 301 | 7,88450 |
| 4SSRR | 324 | 6,12897 |
| 4SYGr | 292 | 8,80118 |
| 4TuWk | 304 | 9,43612 |
| 4XQSp | 328 | 5,13440 |
| 4XSwH | 272 | 5,39336 |
| 4YjaM | 279 | 7,91970 |
| 4enuj | 273 | 5,33112 |
| 4geiZ | 294 | 5,17999 |
| 4muLH | 282 | 6,03945 |
| 4vajX | 267 | 9,20056 |
| 5BjFC | 314 | 5,10115 |
| 5BnBE | 312 | 5,31367 |
| 5BnGZ | 276 | 9,19463 |
| 5HFqw | 294 | 8,57218 |
| 5Heeo | 284 | 9,19714 |
| 5nCWo | 281 | 5,68165 |
| 5nFgD | 324 | 4,96974 |
| 5nNwE | 282 | 8,73303 |
| 5oGTO | 289 | 8,58901 |
| 5tGuU | 280 | 8,99278 |
| 5tx9C | 294 | 8,19736 |
| 5z440 | 292 | 9,06524 |
| 6CCqi | 295 | 8,46136 |
| 6CCyX | 295 | 7,85697 |
| 6CH0d | 297 | 8,44151 |
| 6D5mN | 323 | 4,92404 |
| 6DTza | 295 | 6,89232 |
| 6DX9u | 295 | 7,83595 |
| 6DhPX | 295 | 8,95467 |
| 6DtFV | 279 | 6,82343 |
| 6EBCr | 295 | 7,84653 |
| 6EC8y | 300 | 4,99924 |
| 6ECsd | 321 | 5,20073 |
| 6EupR | 293 | 7,85710 |
| 6FH3F | 253 | 8,33649 |
| 6FoK6 | 327 | 9,58930 |
| 6H2Jq | 297 | 8,47368 |
| 6ITlc | 293 | 6,89380 |
| 6Jf2V | 295 | 8,42765 |
| 6KIch | 327 | 5,91804 |
| 6Kl4u | 311 | 6,49109 |
| 6Kl5M | 293 | 8,77197 |
| 6Klmh | 307 | 5,14725 |
| 6KlrQ | 357 | 6,26635 |
| 6KpoE | 321 | 5,79186 |
| 6N8TN | 291 | 6,13346 |
| 6OeR5 | 326 | 5,34130 |
| 6QfsN | 309 | 5,53120 |
| 6QxUB | 280 | 6,24265 |
| 6RVQB | 295 | 7,18987 |
| 6RXnm | 328 | 5,07415 |
| 6SKxV | 319 | 8,96757 |
| 6T6JU | 328 | 6,33120 |
| 6T6uL | 320 | 6,30011 |
| 6T9TF | 318 | 5,75957 |
| 6THQ3 | 338 | 8,91516 |
| 6TaCc | 297 | 8,26938 |
| 6TaDF | 330 | 5,39410 |
| 6TaE8 | 371 | 5,98437 |
| 6TaIQ | 342 | 5,58843 |
| 6TaWy | 319 | 5,76520 |
| 6TbAA | 335 | 5,59360 |
| 6Tbcc | 350 | 5,86842 |
| 6Tbqd | 304 | 5,29361 |
| 6TcoJ | 350 | 5,75531 |
| 6Te4N | 330 | 5,71820 |
| 6Thkb | 331 | 5,63527 |
| 6Tiff | 293 | 5,20892 |
| 6UdmE | 319 | 5,54973 |
| 6Uy1g | 338 | 8,75740 |
| 6Vb0C | 287 | 5,07529 |
| 6W2Jr | 287 | 7,86974 |
| 71AlB | 321 | 5,79186 |
| 72qg1 | 305 | 7,74911 |
| 7AN3R | 328 | 9,57170 |
| 7AzbX | 326 | 9,57776 |
| 7BFMK | 364 | 8,97975 |
| 7dxit | 370 | 6,79655 |
| 7fkF6 | 338 | 5,35841 |
| 7gnlP | 304 | 6,44960 |
| 7i5O7 | 314 | 4,98571 |
| 7iEvs | 331 | 5,27718 |
| 7ntU3 | 307 | 5,90565 |
| 7o6BN | 289 | 5,03295 |
| 7o6rH | 244 | 8,55484 |
| 7ohYp | 281 | 6,79774 |
| 7pYfb | 327 | 6,44767 |
| 7qTRi | 290 | 7,06107 |
| 7qTVI | 293 | 7,10007 |
| 7u8Iy | 295 | 5,94089 |
| 7uaMl | 351 | 9,78670 |
| 7ucQI | 298 | 6,50240 |
| 7ui8z | 284 | 6,62853 |
| 7ujdv | 331 | 4,99009 |
| 7ulAU | 290 | 7,13059 |
| 7unxR | 347 | 6,39748 |
| 7yggz | 283 | 7,17111 |
| 7zaAp | 325 | 6,04519 |
| 7zcjZ | 283 | 7,16861 |
| 7zckp | 299 | 8,33842 |
| 7zfUp | 325 | 5,13730 |
| 7zkdu | 302 | 6,25459 |
| 7zkgp | 313 | 6,55464 |
| 8JZq1 | 299 | 5,01640 |
| 8Jtq3 | 310 | 8,47735 |
| bird | 326 | 7,18396 |
| bjcm | 277 | 9,43993 |
| gSZ2 | 279 | 9,29977 |
| guGZ | 314 | 5,08609 |
| jFpp | 276 | 9,02798 |
| ttYY | 269 | 9,22763 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_13880
7zjiw
|
12 | 30,8% | 256 | 1.698E-90 |
| 2 |
phalp2_19394
2oOR4
|
46 | 34,2% | 228 | 1.525E-89 |
| 3 |
phalp2_3514
4qzCg
|
10 | 34,9% | 223 | 1.401E-74 |
| 4 |
phalp2_3990
7zjtr
|
195 | 21,0% | 252 | 1.077E-32 |
| 5 |
phalp2_3482
4fDBH
|
6 | 22,3% | 224 | 4.746E-30 |
| 6 |
phalp2_27888
gjQY
|
39 | 22,0% | 240 | 9.211E-27 |
| 7 |
phalp2_29636
8auGQ
|
3 | 20,1% | 223 | 3.135E-19 |
| 8 |
phalp2_39431
7G9zR
|
3 | 21,8% | 238 | 7.044E-12 |
| 9 |
phalp2_31178
7Vvn5
|
47 | 16,0% | 275 | 4.621E-06 |
Domains
Domains
1
337 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(4MaUn)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50