Protein

Protein accession
1mrvp [EnVhog]
Representative
1oDTV
Source
EnVhog (cluster: phalp2_31010)
Protein name
1mrvp
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MTTITDDEFVRLFQERLGLSPIDGWAGRDTLAKLDEIAPPKILPASNGAIPNDYWPMLSKIESNDRPYVKATTSSASGLYQFIKSTWIGEGGTWGTDASQAFGGLAPTAAEQTARAKTFTSKNAAYLRAKGIPINKASLYAAHFFGPLTAAQVIAADVKDRADLIAGPAATKANPSILRDKTVGEFLSWLHKKTGDWAR
Physico‐chemical
properties
protein length:199 AA
molecular weight:21429,0 Da
isoelectric point:9,07
hydropathy:-0,25
Representative Protein Details
Accession
1oDTV
Protein name
1oDTV
Sequence length
131 AA
Molecular weight
14249,88870 Da
Isoelectric point
10,06476
Sequence
SKESGGNFKAKNSLSTATGGFQWLDGTWASMVKNHPDLGLTMDGRGNEAQERRAMRRFTEDNIKHLNRYNIPINNASVYAAHFLGPGGASSVLTKDDSVSLSNLLSPAVLKANPILRNMTVGGFKNWASKR
Other Proteins in cluster: phalp2_31010
Total (incl. this protein): 130 Avg length: 196,2 Avg pI: 9,27

Protein ID Length (AA) pI
1oDTV 131 10,06476
13hnQ 241 9,89114
1KTNQ 153 10,10099
1KWKK 194 9,51619
1MjfQ 197 9,51845
1a3xX 196 9,52045
1eX9U 197 9,42368
1eZbW 197 9,42368
1f6KY 195 9,09612
1kHEP 196 9,27089
1klHA 207 9,54746
1lLKx 196 6,97269
1lvof 197 9,51768
1mrKC 240 9,57860
1mrw8 201 9,09644
1msYo 195 9,39596
1mxQ9 197 9,45295
1mxSh 197 9,54914
1nMcr 240 9,48454
1qOYU 198 9,58086
1qPba 197 9,52026
1qQMA 200 9,69432
1qQkM 200 9,59601
1qnZ2 201 9,39622
1r2m1 187 9,32917
1r3on 187 9,29952
1rHjk 193 9,51987
1rJvv 178 9,54765
1rkeY 199 8,72981
1slY9 202 9,24717
1soqi 180 10,10486
2CaZH 196 6,41794
2SPgE 157 9,80069
2SfoL 156 9,61812
2fMcc 202 9,09534
2g7bs 190 9,25613
2gaZz 198 9,48519
2gccj 198 9,39532
2gpXY 200 9,46675
2hlts 198 9,65229
2prvy 249 8,98768
2psks 166 6,70253
38PLT 154 10,10099
3KIrB 197 6,84219
3MyiS 196 9,29861
3YSsF 240 9,63520
3dIM0 198 9,44173
3e5a4 199 9,58131
42H3M 237 9,39364
42NPH 171 7,78799
42zgD 198 9,54869
4BGXi 224 9,77194
4CN0J 191 9,12571
4DH1G 207 9,48357
4KEUB 156 9,55868
4Lomz 206 5,58741
4MBXC 187 6,73067
4MHNw 185 5,43531
4UDwn 206 9,81320
4c9QY 198 9,69123
4e13o 191 9,29900
4f38E 206 10,04787
4f3dd 214 9,84015
4f3nz 201 7,88901
4f6Zp 206 10,04928
4gE1v 206 9,91996
4gHMO 206 9,68278
4mxoJ 102 9,84685
4nNDS 203 9,69335
4vE5N 201 9,42330
59RUc 200 9,86961
5BmRo 178 9,42168
5F0FR 202 9,12358
5IX5j 202 10,24830
5IZ7f 205 10,39645
5dG5U 202 9,27444
6C3xg 201 8,80246
6D0sA 197 9,39564
6DjJA 170 9,42478
6Dqfa 157 9,73984
6OfzB 197 9,52026
6RpOU 194 9,48390
6Rpl4 195 9,24407
6SZRE 201 9,18412
6SqA9 191 9,62882
6Sqzw 196 9,39557
6SsVO 197 9,10037
6Ssdu 197 9,42368
6SvTy 197 9,39719
6wXyv 214 9,06994
6x06f 193 9,25065
71Uf5 192 9,58227
75Xgv 197 9,32833
7GsLM 153 9,95110
7Yasw 197 9,55430
7ereS 210 7,89675
7gYsH 202 9,15317
7hBr9 197 9,24536
7k46S 197 9,48344
7k4W5 208 9,24465
7lFQp 240 9,69329
7mChB 240 9,32253
7pFiQ 194 8,75192
7qzoB 198 7,95264
7rHEb 198 9,36972
7revx 197 9,27315
7sCqn 207 9,48306
7sROW 237 9,69232
7tI8r 197 9,36972
7tK4s 203 9,83596
7vOfA 191 9,69355
7wTc4 203 9,81352
8Cmbt 197 7,98739
8fjg9 223 10,25307
8fl1L 150 11,18328
8mBy6 195 9,07059
8tAJs 206 10,17532
98oX 208 10,17725
Ipr3 198 9,59601
OVLd 212 9,73519
Qdn6 189 9,43110
YpqP 150 5,13042
e73Z 189 10,10447
gOKo 196 9,52064
hyMf 157 9,62476
iEVB 156 9,73397
lzep 209 10,04168
pbi3 237 9,29732
szwF 200 8,86829
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_18821
1lm7s
3 33,8% 130 1.212E-31
2 phalp2_26026
6VCZH
19 29,1% 137 6.510E-22
3 phalp2_1723
2pp6N
16 29,2% 140 9.154E-19
4 phalp2_20892
6T4HE
1 29,0% 117 9.316E-16
5 phalp2_28559
83bNq
3 23,5% 123 2.668E-13

Domains

Domains
Unannotated
Representative sequence (used for alignment): 1oDTV (131 AA)
Member sequence: 1mrvp (199 AA)
1 131 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (1oDTV) rather than this protein.
PDB ID
1oDTV
Method AlphaFoldv2
Resolution 92.76
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50