Protein

Protein accession
1mhv1 [EnVhog]
Representative
3WNwM
Source
EnVhog (cluster: phalp2_31512)
Protein name
1mhv1
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MSQRFGIDVSHWQGSFDFARAKSKEGVEFAIIKAGGADAGLYKDSQFEANYKKCEECGLPKGAYFYGNARSVADAKKEAEYFLSLLKGKRYEYPVFYDVEGSMITKNDRNTLTQIVNAFCSAVEAAGYWVGIYSSESFFNSEMNDGELTRYTHWVARWGRNKPAPASGAETQIWQFGGETNLIRSNKINGQTCDQDYCYVDFPAKIKAAGLNGYAEGNSSAPAKKSNEEIAAEVIAGKWGNGTERQNRLSQAGYDYSAIQSIVNKKLSPSKKSVDEIAREVIHGDWGNGADRKKRITSAGYDYSAVQKRVNELLK
Physico‐chemical
properties
protein length:315 AA
molecular weight:34947,5 Da
isoelectric point:8,39
hydropathy:-0,63
Representative Protein Details
Accession
3WNwM
Protein name
3WNwM
Sequence length
266 AA
Molecular weight
30819,61590 Da
Isoelectric point
9,34671
Sequence
MQLFGIDISKWQSGINLSQAKNQGVKFAILRGGYTGSSNGITKAKDTSFETFYKQCKSLNIPVGCYWFSRANTYEKGVNEAKFMYENCLKNKQFEYPIYIDVEDSIYQKKNKKGTTEAIIGFCEYLENLGYYVGVYANVDWFKNYIDTNKLNPYDKWIAYWSTKRPSYPEGDLWQFGGETNKIRSNKVANKVCDQDYSYKDYPKIIKAKGLNGFKKQTANKKSIIELAKEVINGKWSNGAERKKRLTESGYNYNEIQKKVNEILHK
Other Proteins in cluster: phalp2_31512
Total (incl. this protein): 280 Avg length: 314,6 Avg pI: 7,09

Protein ID Length (AA) pI
3WNwM 266 9,34671
13AtX 349 5,03942
13AuI 332 8,69371
1Nc 319 9,26406
1cTmk 271 6,97911
1cU5o 263 7,56046
1gAY3 278 9,33194
1gBFC 259 9,14834
1gBL0 310 9,38274
1kf46 316 8,81852
1krBs 311 7,94929
1kvve 263 7,55108
1m0aU 319 9,07007
1nbzj 316 8,91051
1njJr 354 4,86879
1qvMK 298 4,72584
1qwaW 317 4,32547
21AuY 269 9,09689
21GGL 269 9,01934
21Jtp 246 5,13634
21kOg 291 8,38619
21reN 263 4,91074
234tU 246 5,24740
23Afb 320 7,64129
23CJx 311 4,84390
23IGn 259 9,23473
23iB5 263 4,88448
23yqz 321 8,81858
24GT2 269 8,83212
24nZh 248 5,13634
24rz6 279 9,44676
25mcZ 278 4,98134
2Q5qF 363 8,99639
2VhB2 313 9,82326
2VlHb 316 6,84321
2Vm7O 331 6,22259
2fX22 266 8,81878
2mb90 316 8,81852
2nXbK 293 4,68185
2phlw 296 4,62450
2qXt4 289 8,92425
38IqS 269 6,19996
3Asq4 317 8,83173
3B43g 316 8,70164
3B8Cu 283 8,92495
3KQQf 316 8,81852
3TEju 279 9,25664
3TP8J 267 8,39825
3VKJx 290 9,21964
3WCnW 286 9,51916
3WJ9z 316 8,53099
3WzMz 283 5,98540
3ZGGc 349 4,99935
3dS2g 297 5,23944
3fOP8 301 6,90289
3ggg5 378 4,70567
3ihFP 267 8,36008
3in3S 271 9,38616
3inPX 291 5,02129
3kJKn 354 4,85191
3kQb9 285 8,86468
3kmr7 317 9,19656
3l0Rl 315 8,67714
3l65x 298 9,31976
3lc2l 355 4,64002
3lkOI 354 4,87215
3lo9N 315 8,91741
3m9NL 316 8,91748
3mfnw 317 9,13390
3mvJK 316 8,99639
3mwXz 317 8,81858
3nY6g 267 8,54839
3oQAo 315 9,13512
3ondT 317 8,91741
3ooa4 299 6,18757
3pJlX 316 8,81852
3pKQY 354 4,87215
3pbiS 354 4,94882
3phl6 316 8,55742
3r8cy 354 4,82719
3s5W6 317 8,37633
3s7HF 315 9,02643
3se0m 316 8,81852
3szxK 262 5,46674
3tCjG 355 4,78229
3tDi8 316 8,69525
3tIYx 318 5,43161
3td7y 316 8,70783
3tmoF 370 5,64436
3trZy 316 8,81852
3u0RI 316 8,56309
3uXQ1 300 9,20120
3ueI3 347 4,95167
3upI3 320 4,93660
3upYB 354 4,78069
3vTlW 316 9,08819
3wcXW 316 5,03397
3xMqk 318 5,31993
3xYwK 354 5,04858
3yCYq 354 4,87215
3yEym 317 9,14157
3zsTd 317 6,08606
40lbM 241 5,97482
414Or 311 9,32646
419DO 322 5,26064
41fwp 315 7,05170
41iHB 283 8,37646
41qyW 269 8,83231
45AIn 349 4,90870
4L6s5 295 5,08080
4L7cY 295 9,02088
4L99K 239 5,98409
4La1E 313 5,52381
4Mhzx 316 8,04219
4k9S2 278 6,75613
4kof0 193 5,98875
4ybUN 348 9,17490
4yoxl 291 9,19379
4z7TF 316 5,66914
5KKPk 354 4,91364
5KPpK 354 4,95297
5KS4i 319 9,39100
5KZ31 354 4,91364
5KeQ1 354 4,91364
5KjCG 335 8,86435
5Lnlp 354 4,84174
5Myz0 354 4,81178
5NHuK 354 5,04141
5NMmn 354 4,87868
5NWfp 276 4,91870
5NlKM 354 4,76933
5O9My 354 4,77654
5OL38 354 4,84856
5Ogf8 318 6,83201
5Pt6G 263 7,54318
5QME1 277 6,06076
5QrGV 316 5,61691
5RTnr 324 9,17599
5RrOR 354 4,95951
5Rx3N 308 8,73374
5T1tU 270 9,53637
5TE4E 354 4,78086
5TVoP 319 9,31415
5Txdp 319 9,24569
5VNMn 308 8,83605
5VSBn 354 4,87215
5VczO 299 8,93301
5Vzfc 354 4,91364
5WaKk 291 9,06479
5WxhC 265 8,66618
5Xwt6 318 5,21779
5YDci 335 8,80582
5YR8j 299 5,92356
5YaIy 355 4,74790
5Ydfz 308 8,61415
5Yxu7 354 4,90699
5YyNj 319 9,25291
5Zn70 354 4,91364
5kgY 318 5,87382
5nUr 313 9,05505
5sFM 315 6,66741
60cad 263 8,09331
60fia 354 4,91364
616eJ 354 4,84856
61FDi 318 9,12178
61OIX 354 4,84856
61Pou 354 4,91364
61gw7 319 9,08316
61kX7 299 9,24949
62KQB 354 4,91949
62crM 354 4,87215
62tLt 354 4,76933
63g5o 335 8,68977
64NMr 254 8,69525
64Y7p 354 4,79723
64lfS 266 8,79995
66ZE6 354 4,87215
66yOc 354 4,95746
67Gjq 319 9,33955
67I6Y 354 4,85242
67bbl 319 9,28520
67bgq 319 9,38732
68FDF 354 4,86879
68IdF 354 4,87215
68SKP 354 4,95167
68y5i 354 4,98662
69x6o 280 5,22927
6a7Y8 355 4,67497
6aqs1 354 4,90699
6awdi 354 4,87215
6b4ex 309 8,55452
6bVdQ 354 4,82719
6bpAQ 318 7,48845
6cPKT 355 4,78229
6cmgv 323 9,22486
6d8Me 268 8,81252
6dBLW 354 5,00674
6e3mx 319 9,25722
6e8tc 354 4,87215
6eB1T 268 8,53215
6eOwE 355 4,70874
6fWo0 354 4,91364
6gJQY 354 4,95167
6gKLU 354 4,90335
6hdoL 299 8,04077
6hjOm 270 5,59389
6i6Cu 315 8,81852
6iM3W 319 9,28765
6jRU6 354 4,75455
6jqAp 313 9,28288
6kr4d 244 8,99600
6lrQQ 354 4,95167
6m4N2 312 5,47845
6mqTp 300 9,01566
6mvVu 319 9,35361
6nIYF 289 9,68368
6ns64 354 4,78763
6pBjg 319 9,33962
6pBuh 319 9,30751
6pJuH 354 4,91364
6q6lm 268 8,91793
6r6dr 354 4,87215
6rixN 354 4,74756
6ru33 354 5,00043
6rul2 250 9,10534
6rxJz 274 9,49524
6t38F 316 9,01263
6tgjV 354 4,95951
6uON2 350 4,80508
6vFjX 354 4,87215
6vepY 354 4,97844
6vsw1 319 9,31441
709eL 354 4,95832
71hFJ 309 6,88391
74Zz0 316 5,49954
7DSOu 269 8,05624
7DTVL 278 9,30100
7LkTA 212 9,71979
7NII4 354 4,95832
7NcqU 354 4,92342
7UTKD 272 8,12226
7Ujdl 276 4,97582
7Y8se 318 5,53063
7ZN0x 279 5,32260
7ZhbT 316 8,81852
7aLbY 305 4,68208
7qSBR 316 8,55749
7qu7i 316 8,70164
7rUon 316 8,82509
7rqbY 319 9,39480
7sil7 318 9,14163
7t4zv 315 8,72678
7wa3m 318 8,94107
7xzF6 315 8,83863
80E7d 316 8,01086
80PQH 319 8,54382
812MK 263 6,82315
87AyJ 331 8,82471
87Rj6 350 5,03942
88bDB 354 4,87215
88ml3 354 4,87215
8K2tP 283 8,92618
8fNT3 316 8,70164
8fxdt 279 9,80411
8l6s8 310 9,46958
8mhDe 240 5,36142
8qV1o 299 8,33255
8qVOx 274 7,07574
9ZKM 314 6,77165
A1l6 316 8,81852
CSp9 354 5,00043
NwpV 317 9,19656
Ozfx 316 8,55736
a02S 286 9,49137
qalP 354 4,87215
rjFt 354 4,87215
xsGS 273 9,50220
A0A2K5B2A3 312 8,86435
A0A4D6BGJ6 312 8,61931
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_529
o3Q8
73 62,7% 228 9.423E-118
2 phalp2_26548
858CP
728 40,3% 265 4.050E-103
3 phalp2_3425
3TK4D
923 41,7% 218 6.628E-89
4 phalp2_6199
5X5xO
102 46,1% 223 1.392E-86
5 phalp2_10110
c1k0
16 35,6% 219 2.998E-72
6 phalp2_23789
19iit
3 33,9% 227 1.973E-68
7 phalp2_15589
2brBA
13 34,3% 224 1.598E-66
8 phalp2_2537
6a7No
192 33,7% 219 5.607E-66
9 phalp2_14273
3kLGA
7 36,1% 166 7.673E-66
10 phalp2_38437
1cCmC
101 33,5% 283 6.900E-65

Domains

Domains
Representative sequence (used for alignment): 3WNwM (266 AA)
Member sequence: 1mhv1 (315 AA)
1 266 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01183|PF08230

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (3WNwM) rather than this protein.
PDB ID
3WNwM
Method AlphaFoldv2
Resolution 95.34
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50