Protein
- Protein accession
- 1lkoo [EnVhog]
- Representative
- 1o9gv
- Source
- EnVhog (cluster: phalp2_28381)
- Protein name
- 1lkoo
- Lysin probability
- 98%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MILLSALAEVMVDLQPTPAPTVIAAGVVGGEREPQPSRGQVSRVVARAGLLTGHWGAFQRCVAHRESKGSPTVVNSSGHAGVYQFSIRWRHGLPFVVQRGLVHAGMSNRQARAIRLSLPSRIERWPARFQHVGFAQVIREGGRDAAMRHWGLNGSRCQGLAR
- Physico‐chemical
properties -
protein length: 162 AA molecular weight: 17642,1 Da isoelectric point: 11,83 hydropathy: -0,16
Representative Protein Details
- Accession
- 1o9gv
- Protein name
- 1o9gv
- Sequence length
- 151 AA
- Molecular weight
- 16919,01010 Da
- Isoelectric point
- 11,15988
- Sequence
-
MLDVLVAAAVEVSTNDREWSVQRPSRSISAVRAASSAPPRWRAFAECVLHRESGASLNRPQSGAGALNASNHAGRWQFAANWRHGLPYMVRDRLIRFGATHKQARTVRVWLSGHPIQQWPGLYQDMGAFEVMERGGSFHWKLAGSRCEVLR
Other Proteins in cluster: phalp2_28381
| Total (incl. this protein): 124 | Avg length: 146,4 | Avg pI: 10,12 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 1o9gv | 151 | 11,15988 |
| 16orP | 161 | 10,72981 |
| 1A2z0 | 176 | 9,62695 |
| 1A98K | 172 | 10,19305 |
| 1AE2M | 155 | 10,98575 |
| 1ALFO | 143 | 9,72404 |
| 1Akq0 | 169 | 9,30081 |
| 1Blev | 161 | 10,06340 |
| 1I13m | 148 | 10,92560 |
| 1JDFM | 132 | 10,84179 |
| 1L1J7 | 167 | 10,13445 |
| 1OpAb | 172 | 10,19305 |
| 1VUka | 156 | 9,26051 |
| 1XHwz | 155 | 10,19331 |
| 1aCNb | 142 | 10,00841 |
| 1cVv6 | 147 | 8,78493 |
| 1dSJZ | 158 | 9,55610 |
| 1o9Dk | 143 | 11,09206 |
| 1pZBU | 151 | 10,80608 |
| 1pcRS | 137 | 11,54734 |
| 22Wmd | 149 | 9,65203 |
| 270Ug | 119 | 10,10144 |
| 2JVmq | 128 | 10,23334 |
| 2RtA2 | 153 | 9,92505 |
| 2Xyen | 130 | 9,96573 |
| 2Z7fL | 147 | 8,05205 |
| 2d0vp | 146 | 9,80888 |
| 2hN3d | 146 | 9,72836 |
| 2qBLC | 149 | 11,35225 |
| 31Zy4 | 130 | 9,78896 |
| 33UB7 | 142 | 8,66031 |
| 37Fe9 | 146 | 9,84240 |
| 38cZO | 146 | 9,80888 |
| 38i49 | 146 | 9,89018 |
| 3XtOu | 150 | 9,17722 |
| 3bhqU | 163 | 10,00725 |
| 46Ne0 | 142 | 10,51184 |
| 46No1 | 146 | 9,75589 |
| 46sTF | 135 | 9,89682 |
| 47fqO | 147 | 10,23076 |
| 47o8G | 147 | 10,27518 |
| 48BZT | 146 | 9,80888 |
| 4BTqn | 147 | 10,01067 |
| 4NLWQ | 140 | 11,06750 |
| 4NO3P | 137 | 11,23428 |
| 4NQ8W | 137 | 10,74741 |
| 4O515 | 144 | 11,23737 |
| 4OAmJ | 142 | 10,71718 |
| 4YdJG | 137 | 11,08452 |
| 4YfXg | 137 | 11,08452 |
| 4bSto | 142 | 10,24688 |
| 4bTi4 | 145 | 10,25545 |
| 4gjZQ | 142 | 10,71718 |
| 4hhqs | 172 | 10,04052 |
| 4lRwj | 146 | 9,88992 |
| 4nUER | 136 | 9,93285 |
| 4qMXC | 143 | 9,68813 |
| 57rSD | 146 | 9,84240 |
| 5Cezt | 146 | 9,80888 |
| 5DMOB | 144 | 11,10018 |
| 5DNFN | 165 | 9,35489 |
| 5JChd | 146 | 11,53592 |
| 5JClQ | 140 | 11,23428 |
| 5acQx | 139 | 9,81816 |
| 5bb4Z | 136 | 9,91712 |
| 5bc9o | 118 | 8,78499 |
| 5d6cz | 144 | 10,84083 |
| 5e0N9 | 130 | 9,96573 |
| 5fvbE | 155 | 10,32605 |
| 5fvht | 144 | 11,02379 |
| 5hKkM | 150 | 10,62821 |
| 5hoWy | 146 | 9,88992 |
| 5j2Uu | 137 | 11,06750 |
| 5j8cy | 144 | 11,32002 |
| 5me0k | 144 | 10,49528 |
| 5vMSW | 142 | 11,00490 |
| 6LWva | 146 | 9,80888 |
| 6LbNB | 137 | 11,25381 |
| 6PFrg | 117 | 11,00683 |
| 6PLwK | 162 | 11,07323 |
| 6QXoT | 156 | 9,68143 |
| 6VAAh | 156 | 9,89727 |
| 6xRnO | 146 | 9,75589 |
| 6yLYc | 118 | 9,23601 |
| 6yWif | 147 | 8,76991 |
| 6z3TV | 146 | 9,88992 |
| 7DUX | 118 | 9,79663 |
| 7JWPl | 142 | 10,74741 |
| 7V7KG | 176 | 9,82422 |
| 7XIsQ | 140 | 10,26016 |
| 7zgT | 161 | 9,79238 |
| 80mJ8 | 143 | 6,57982 |
| 81svE | 142 | 9,68484 |
| 83IGs | 150 | 10,12117 |
| 83Ibm | 146 | 9,59072 |
| 87ZZ7 | 150 | 10,12117 |
| 87rpK | 140 | 10,52061 |
| 892eC | 158 | 9,61876 |
| 89PRS | 176 | 9,69484 |
| 8EI8Z | 176 | 9,82422 |
| 8dZ0o | 142 | 10,56999 |
| 8dZPv | 142 | 10,11285 |
| 8dZZe | 142 | 10,96267 |
| 8e9q1 | 137 | 9,80888 |
| 8eHVe | 121 | 10,85952 |
| 8jqIf | 147 | 7,92215 |
| 8rT7Y | 150 | 9,82326 |
| 8sFSs | 142 | 10,74561 |
| 8sGJo | 142 | 10,77397 |
| 8sGMF | 172 | 9,82635 |
| ABRo | 155 | 10,23038 |
| AvtS | 142 | 10,79525 |
| CgLp | 132 | 10,73187 |
| Cja8 | 146 | 9,80888 |
| LKTf | 146 | 9,88934 |
| LjOk | 146 | 9,84182 |
| QbxV | 146 | 9,46262 |
| SxJN | 146 | 9,78902 |
| gDEq | 130 | 9,93885 |
| jOBq | 146 | 9,92641 |
| jaNw | 183 | 6,47137 |
| jnI0 | 151 | 10,52487 |
| sDEP | 119 | 10,46414 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_32811
2GfCO
|
95 | 21,1% | 151 | 2.065E-13 |
| 2 |
phalp2_40252
2M3BD
|
51 | 25,0% | 112 | 1.046E-10 |
| 3 |
phalp2_26867
4ajOR
|
1 | 25,7% | 105 | 1.488E-08 |
| 4 |
phalp2_25209
24UWi
|
7 | 24,8% | 149 | 3.758E-08 |
| 5 |
phalp2_33656
RNZK
|
28 | 21,0% | 114 | 8.054E-05 |
Domains
Domains
1
151 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50
The structures below correspond to the cluster representative
(1o9gv)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50