Protein
- Protein accession
- 1liZa [EnVhog]
- Representative
- 173qx
- Source
- EnVhog (cluster: phalp2_30952)
- Protein name
- 1liZa
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MLKIEQRRIAHNYTKGRAGHKPRAIVIHIMSGYYNGTDAWFHNPASGASTHYGVSRKGQVRQWVGELDSAWHCGTLIKPTWKLIDPRVDPKFETIGIEHEGFQTDVWTPEMKAASAELIANIARRWKFPLDRDHVIGHYQLSGGRRDNCPSQGRNANHIIEELIELAKKF
- Physico‐chemical
properties -
protein length: 170 AA molecular weight: 19420,8 Da isoelectric point: 9,45 hydropathy: -0,61
Representative Protein Details
- Accession
- 173qx
- Protein name
- 173qx
- Sequence length
- 198 AA
- Molecular weight
- 22228,06210 Da
- Isoelectric point
- 8,42378
- Sequence
-
MNTIQKIWKGSPNFWTGRKGYKPELVVIHIMDGTLFGTDAWFANPASQVSAHYGIGKSGEIHQYVKEEDAAWHAGRVDAPSSKLIKTNVNPNLYTIGIEHEGKPEDKWTDAMKQASALLIREICQRWQIPIDRNHIIGHYEIYSKKPNCPSHDKKIINELVALANGQTSNQQSTISSVVEEGIKKIEEGLAIIKQTLK
Other Proteins in cluster: phalp2_30952
| Total (incl. this protein): 118 | Avg length: 196,8 | Avg pI: 7,19 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 173qx | 198 | 8,42378 |
| 10H99 | 163 | 7,15145 |
| 118kg | 173 | 10,23295 |
| 1AQLF | 226 | 5,39922 |
| 1H2Qp | 165 | 9,62289 |
| 1IcMQ | 227 | 6,36156 |
| 1LBWQ | 183 | 8,25506 |
| 1br4F | 229 | 7,88869 |
| 1cqCZ | 249 | 5,16686 |
| 1dcId | 251 | 4,73119 |
| 1faQO | 221 | 7,12803 |
| 1fahS | 203 | 7,09558 |
| 1iEsF | 190 | 8,46536 |
| 1kBmE | 230 | 4,64172 |
| 1lDDp | 171 | 9,12171 |
| 1op9x | 170 | 5,30316 |
| 1ptaw | 164 | 6,43027 |
| 1uNDY | 167 | 8,54163 |
| 1yd5X | 163 | 7,25222 |
| 255j0 | 190 | 5,60929 |
| 25l4Y | 252 | 4,59284 |
| 2Ag2G | 191 | 7,77258 |
| 2Ancs | 188 | 5,59247 |
| 2D8wk | 189 | 6,75267 |
| 2TDg5 | 205 | 6,12204 |
| 2amUe | 189 | 6,64876 |
| 2an60 | 160 | 6,95365 |
| 2sJKI | 250 | 7,87019 |
| 2sK1W | 246 | 5,74224 |
| 2t8Ll | 250 | 5,61242 |
| 2t9Lf | 188 | 7,84176 |
| 2teO1 | 240 | 6,11124 |
| 2tfsC | 253 | 5,97590 |
| 2tkmj | 191 | 7,82319 |
| 34zRb | 217 | 4,86368 |
| 3FuO3 | 253 | 6,10396 |
| 3J2E | 246 | 6,70538 |
| 3JUvO | 235 | 9,24723 |
| 3O | 236 | 6,78921 |
| 3QwWM | 192 | 6,58880 |
| 3QyhK | 144 | 6,63825 |
| 3SQU3 | 181 | 5,21295 |
| 3d2EB | 195 | 6,78938 |
| 3ekuT | 227 | 9,17155 |
| 3fgJu | 167 | 7,94381 |
| 3j | 236 | 7,14866 |
| 3ncOb | 171 | 9,18457 |
| 3yTfd | 236 | 9,66460 |
| 4AZjw | 188 | 9,00129 |
| 4DjVx | 169 | 7,87644 |
| 4Eoi4 | 230 | 5,74207 |
| 4G4SW | 163 | 7,71035 |
| 4Gd3K | 152 | 7,77523 |
| 4H4Rl | 258 | 6,22043 |
| 4HVmq | 167 | 6,38543 |
| 4LApY | 154 | 6,08742 |
| 4MYh0 | 161 | 5,78265 |
| 4O8eB | 195 | 8,44047 |
| 4XKG0 | 173 | 5,18533 |
| 4dKWv | 161 | 6,09402 |
| 4elpK | 161 | 7,82848 |
| 4g1UR | 162 | 8,60932 |
| 4hEX5 | 197 | 6,25714 |
| 4qRcD | 177 | 6,01501 |
| 4wNXQ | 194 | 6,16756 |
| 4yS0B | 167 | 6,85407 |
| 5EHdj | 155 | 5,73712 |
| 5HkrM | 205 | 8,54182 |
| 5IW2S | 168 | 9,63288 |
| 5IdAI | 182 | 7,09273 |
| 5JCpx | 176 | 5,87570 |
| 5LWF | 254 | 6,11186 |
| 5zFV8 | 203 | 7,28064 |
| 5zIRb | 195 | 6,16023 |
| 6DdaM | 177 | 5,52244 |
| 6ErT1 | 164 | 5,37614 |
| 6Fwqs | 185 | 7,08978 |
| 6HS69 | 202 | 9,34239 |
| 6Ib6V | 144 | 7,73229 |
| 6IgBK | 142 | 5,30179 |
| 6STQ7 | 225 | 6,00171 |
| 6TMFc | 163 | 5,22319 |
| 6U2aj | 186 | 5,94561 |
| 6UZRq | 170 | 8,98001 |
| 6WTR | 165 | 7,11632 |
| 71Ra0 | 211 | 7,05931 |
| 71XJp | 236 | 6,54111 |
| 71XV3 | 237 | 6,49507 |
| 71XW3 | 175 | 9,15330 |
| 71ZUI | 237 | 7,14974 |
| 7294D | 175 | 9,38893 |
| 729y8 | 175 | 9,25110 |
| 72tcC | 236 | 6,85901 |
| 79gbO | 236 | 6,88959 |
| 79gbp | 197 | 6,22241 |
| 7ATMz | 241 | 8,33488 |
| 7BvQ3 | 176 | 9,27702 |
| 7E6nH | 152 | 9,15285 |
| 7FW5m | 250 | 6,82064 |
| 7IDdM | 188 | 9,15762 |
| 7J5Yr | 196 | 6,54344 |
| 7vWjR | 236 | 8,33384 |
| 7z5KB | 226 | 8,97595 |
| 8aQKl | 151 | 7,81861 |
| 8eIDT | 190 | 9,03745 |
| 8fgzS | 197 | 6,66627 |
| 8iWVQ | 173 | 7,73064 |
| 8jh5Y | 256 | 5,38466 |
| 93NX | 203 | 9,29977 |
| 9tXd | 167 | 9,09966 |
| 9tZU | 167 | 9,02830 |
| R8Ty | 207 | 7,27405 |
| UCH0 | 194 | 7,01378 |
| eRG3 | 239 | 9,51529 |
| eYcd | 219 | 6,78319 |
| gctI | 167 | 4,72590 |
| z26Z | 196 | 7,09842 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_28639
8jnfC
|
92 | 60,4% | 139 | 1.097E-72 |
| 2 |
phalp2_12587
1lnEh
|
1 | 56,2% | 160 | 2.806E-59 |
| 3 |
phalp2_13794
6WRQm
|
7 | 45,6% | 151 | 7.352E-56 |
| 4 |
phalp2_38567
1Qoq7
|
13 | 58,7% | 131 | 1.249E-54 |
| 5 |
phalp2_18213
4LQlA
|
5 | 46,6% | 165 | 9.264E-52 |
| 6 |
phalp2_24509
4NPVU
|
68 | 40,6% | 165 | 5.004E-49 |
| 7 |
phalp2_38112
6KhfV
|
6 | 35,8% | 195 | 1.761E-48 |
| 8 |
phalp2_16178
4A1r9
|
27 | 36,6% | 202 | 1.162E-47 |
| 9 |
phalp2_7185
37Lr4
|
31 | 36,6% | 180 | 1.172E-44 |
| 10 |
phalp2_28537
40K7Z
|
71 | 35,9% | 164 | 5.641E-44 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(173qx)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50