Protein
- Protein accession
- 1lSnQ [EnVhog]
- Representative
- 4Y6qY
- Source
- EnVhog (cluster: phalp2_27484)
- Protein name
- 1lSnQ
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MAVFLTSYFWMLDNEDSAHAYAVVPDDPPGSHAISGINSSSFPSQFEAIQAIPQNQRGPAVQNFYQTQFWNKWFAQLTSDEVAKRVYDASVNMGGGTAVHLLQQAVNDSSPATVLNEDSQWGPKTVGATNACDPVALVAAFKSARVFHYECIVKANPQDEKYLAGWIARAEK
- Physico‐chemical
properties -
protein length: 172 AA molecular weight: 18844,8 Da isoelectric point: 5,03 hydropathy: -0,25
Representative Protein Details
- Accession
- 4Y6qY
- Protein name
- 4Y6qY
- Sequence length
- 171 AA
- Molecular weight
- 18501,96820 Da
- Isoelectric point
- 5,01294
- Sequence
-
MADFQTCYKFMLPNEDAVPTYAVAPDPPPGAYAISGINSFSFPTQYAAIAAIPQAERGPAVMQFYLTTFWNQWLEQLTSDAVAMRVFDASVNMGVKEAIVLLQQAVNSLSTTPLVVDGKIGPKTVAAANACVDTSLVSAFQHARVSYYEEIVAKNPADAIYLKGWTARALK
Other Proteins in cluster: phalp2_27484
| Total (incl. this protein): 125 | Avg length: 181,6 | Avg pI: 6,05 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 4Y6qY | 171 | 5,01294 |
| 107tE | 181 | 8,52048 |
| 109Ss | 166 | 8,87525 |
| 10nft | 165 | 5,61998 |
| 13h36 | 203 | 7,95413 |
| 16CXz | 179 | 7,82532 |
| 16QFk | 183 | 8,32798 |
| 16jrt | 171 | 4,72852 |
| 179mN | 179 | 7,77903 |
| 18RQE | 203 | 7,91925 |
| 1BHLY | 168 | 6,57931 |
| 1Dfa1 | 202 | 4,45233 |
| 1Dkvk | 164 | 8,04148 |
| 1Dz8c | 178 | 5,71882 |
| 1IJJD | 158 | 4,61541 |
| 1Lo3g | 182 | 7,89494 |
| 1SLAo | 178 | 5,34550 |
| 1TpL1 | 177 | 5,98795 |
| 1WqCA | 265 | 4,83225 |
| 1Y3dD | 171 | 4,59790 |
| 1kMSv | 168 | 4,73693 |
| 1l1uz | 175 | 8,57173 |
| 1mAT1 | 171 | 4,70947 |
| 1nDjw | 222 | 9,44102 |
| 1ofMY | 162 | 8,54478 |
| 2Bhsw | 208 | 5,19266 |
| 2FQEU | 166 | 4,49570 |
| 2TDp7 | 178 | 5,51556 |
| 2V99Z | 187 | 6,57322 |
| 2n6Kn | 195 | 9,73732 |
| 2nuZr | 195 | 9,64062 |
| 2oPUg | 171 | 5,31572 |
| 2pMFJ | 173 | 5,24666 |
| 2pMqP | 190 | 5,90997 |
| 2tv5o | 193 | 5,02561 |
| 34SdZ | 202 | 9,61019 |
| 35k0L | 171 | 4,65576 |
| 3JOsF | 208 | 5,28861 |
| 3JX2g | 176 | 5,92276 |
| 3JnFS | 208 | 5,65402 |
| 3UXxm | 207 | 4,82474 |
| 3Vb8x | 204 | 5,00583 |
| 3erg5 | 192 | 5,55336 |
| 3f5em | 169 | 5,56428 |
| 3g1HH | 177 | 5,22250 |
| 3xKOA | 170 | 4,63951 |
| 3yK5N | 173 | 4,84663 |
| 3ySLX | 192 | 6,30892 |
| 3zO5b | 163 | 5,33203 |
| 3zSrF | 184 | 5,85677 |
| 3zbZp | 170 | 8,00448 |
| 3zeAv | 163 | 4,96883 |
| 47UQZ | 127 | 5,19226 |
| 48uxZ | 179 | 5,81010 |
| 48x0L | 214 | 4,94143 |
| 48zBV | 194 | 4,46779 |
| 4AFN8 | 192 | 4,81411 |
| 4AGoy | 225 | 4,78058 |
| 4CIno | 170 | 5,94839 |
| 4CSsk | 168 | 5,38762 |
| 4Ea6W | 185 | 4,88033 |
| 4FoWM | 169 | 5,12332 |
| 4Fow9 | 175 | 5,44207 |
| 4Fykw | 186 | 5,67943 |
| 4Fyt3 | 180 | 4,74392 |
| 4I5VZ | 182 | 6,58874 |
| 4I74e | 165 | 5,03209 |
| 4IHHH | 169 | 5,21818 |
| 4IcWD | 171 | 5,85541 |
| 4Iq92 | 187 | 4,62217 |
| 4JDrr | 171 | 5,01891 |
| 4JqnB | 199 | 7,92595 |
| 4KUCY | 159 | 5,54927 |
| 4KXCh | 168 | 4,64275 |
| 4KeoY | 170 | 5,84017 |
| 4MDx8 | 169 | 5,00367 |
| 4R0kJ | 159 | 5,32834 |
| 4SmoG | 171 | 5,23882 |
| 4TEaP | 177 | 5,89485 |
| 4TzRv | 185 | 5,20329 |
| 4WpqL | 187 | 5,93015 |
| 4X7VY | 211 | 5,34329 |
| 4Y2Ub | 184 | 7,93917 |
| 4d3Tf | 169 | 5,01015 |
| 4dIfV | 178 | 5,53506 |
| 4dNXa | 183 | 4,85430 |
| 4i4Ii | 157 | 9,51581 |
| 5JzMQ | 187 | 4,85066 |
| 5JzSC | 192 | 4,74460 |
| 6BTZg | 203 | 8,92328 |
| 6J4Ap | 180 | 5,70359 |
| 6Lvrp | 170 | 5,50079 |
| 6MW3N | 181 | 9,29939 |
| 6MZbB | 204 | 9,32395 |
| 6OR6F | 168 | 5,70217 |
| 6ORBn | 176 | 4,98742 |
| 6OSSm | 169 | 5,00157 |
| 6OSyy | 172 | 5,05415 |
| 6OTm0 | 177 | 4,68373 |
| 6PDcX | 174 | 5,41297 |
| 6WvIf | 199 | 6,82582 |
| 6XBWP | 168 | 4,36742 |
| 6XHGT | 171 | 4,73329 |
| 6XNC8 | 170 | 5,73070 |
| 6fRO | 190 | 5,15907 |
| 72dNM | 203 | 9,67769 |
| 7UhEp | 235 | 9,50259 |
| 7p8HQ | 178 | 5,37284 |
| 86mka | 171 | 5,37523 |
| 8Fzx3 | 181 | 6,74880 |
| 8dHEW | 204 | 9,13731 |
| 8pbNW | 171 | 5,90287 |
| 8zaMA | 177 | 5,98795 |
| A5pE | 180 | 5,48425 |
| NRaR | 217 | 4,89642 |
| VnjY | 183 | 6,43170 |
| XKIT | 168 | 5,95772 |
| ZtzY | 167 | 4,89994 |
| aNkd | 189 | 5,66761 |
| gd8M | 170 | 4,96570 |
| i7y9 | 183 | 6,43795 |
| k1D6 | 168 | 6,43067 |
| lSxG | 193 | 9,38223 |
| zxET | 179 | 6,17711 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_12184
6C2VC
|
988 | 33,8% | 177 | 1.526E-42 |
| 2 |
phalp2_23510
6Y4uI
|
354 | 35,5% | 183 | 3.279E-37 |
| 3 |
phalp2_25836
5fx9S
|
68 | 30,6% | 183 | 1.154E-36 |
| 4 |
phalp2_40381
3TbBc
|
289 | 32,0% | 175 | 2.967E-36 |
| 5 |
phalp2_34912
4ndwJ
|
921 | 35,2% | 176 | 1.430E-35 |
| 6 |
phalp2_28839
4XJZ6
|
27 | 36,8% | 171 | 1.169E-33 |
| 7 |
phalp2_38528
1E3i8
|
441 | 30,2% | 192 | 6.281E-31 |
| 8 |
phalp2_27064
2jB8e
|
50 | 32,9% | 176 | 1.612E-30 |
| 9 |
phalp2_23735
PTzZ
|
309 | 30,2% | 172 | 3.022E-30 |
| 10 |
phalp2_33644
MZBN
|
1 | 32,9% | 176 | 5.664E-30 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(4Y6qY)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50