Protein
- Protein accession
- 1l7Bb [EnVhog]
- Representative
- 4OkMH
- Source
- EnVhog (cluster: phalp2_18221)
- Protein name
- 1l7Bb
- Lysin probability
- 82%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MDLTNAVILIKSYEGILDGDPSTVNLDPYLCPAGYWTIGWGHVVLDRKGNQIKGIENKKLAYSIYPKGITMAEAEVLLRDDLRRFTYGVTTLVKVSLTNNQLCALISFSFNVGLNALKNSTLLKLVNSEKFKEVPDQFRKWNKSKGKVLAGLVKRREAEINVWKY
- Physico‐chemical
properties -
protein length: 165 AA molecular weight: 18625,5 Da isoelectric point: 9,47 hydropathy: -0,16
Representative Protein Details
- Accession
- 4OkMH
- Protein name
- 4OkMH
- Sequence length
- 174 AA
- Molecular weight
- 19116,30970 Da
- Isoelectric point
- 4,56721
- Sequence
-
MKTSDDGIALIKAFEGIRDGDPSTVNLDPYLCPADVATIGWGHAIVTPLGHQLRGRAGLNEARQMYPNGITIEEAEELLRLDLLERERAVESMVNVPLSQGQFDALVSFAFNVGTDIDEDDIPEGLGDSTLLRKLNAGDYQGAADEFLKWVYAGGRKLLGLERRRAAERELFLT
Other Proteins in cluster: phalp2_18221
| Total (incl. this protein): 137 | Avg length: 167,9 | Avg pI: 8,27 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 4OkMH | 174 | 4,56721 |
| 103En | 174 | 8,69171 |
| 11ypR | 203 | 9,71044 |
| 12CZ1 | 165 | 9,27934 |
| 14zSP | 180 | 5,47782 |
| 191Iu | 168 | 8,53234 |
| 1HMf8 | 168 | 10,03504 |
| 1I01M | 165 | 9,60439 |
| 1J21j | 146 | 9,05653 |
| 1J4kV | 141 | 9,23834 |
| 1JK7M | 163 | 9,40621 |
| 1Jzpw | 168 | 8,96970 |
| 1KA7A | 164 | 9,69638 |
| 1KAdY | 164 | 9,54566 |
| 1KMHK | 163 | 9,72410 |
| 1KQo2 | 164 | 9,56629 |
| 1LQpd | 158 | 9,61470 |
| 1MBrg | 164 | 9,41814 |
| 1MCgE | 141 | 9,23834 |
| 1Q5M1 | 176 | 7,91783 |
| 1bdlF | 173 | 9,80579 |
| 1dDfQ | 173 | 9,80579 |
| 1jKKF | 177 | 9,12777 |
| 1kQ7h | 156 | 4,87380 |
| 1nJQ9 | 172 | 7,95219 |
| 1okYp | 160 | 8,61641 |
| 1qvMl | 142 | 9,53908 |
| 20B2p | 168 | 9,41988 |
| 254G1 | 149 | 5,39302 |
| 2555k | 150 | 4,99310 |
| 2CJJ | 168 | 6,42573 |
| 2IFKT | 164 | 9,47738 |
| 2JM5 | 203 | 8,74496 |
| 2SoWO | 203 | 6,46847 |
| 2UDln | 143 | 5,37773 |
| 2ctSs | 183 | 5,57098 |
| 2j26t | 163 | 9,41814 |
| 2twBm | 166 | 9,48802 |
| 3Muc6 | 144 | 5,88166 |
| 3Ooyd | 179 | 9,12068 |
| 3P8L4 | 166 | 6,88453 |
| 3PbQ8 | 166 | 6,35985 |
| 3SYTd | 166 | 7,86606 |
| 3VTg | 211 | 6,84014 |
| 3ZpXM | 216 | 5,74201 |
| 3cyfd | 165 | 9,38648 |
| 3dGcV | 143 | 9,82429 |
| 3eMqT | 153 | 8,57154 |
| 3emuO | 151 | 9,83596 |
| 3fqEN | 174 | 6,57521 |
| 3fsFF | 167 | 9,31995 |
| 44SJA | 175 | 9,36050 |
| 4BHPp | 170 | 9,49453 |
| 4FFdR | 164 | 9,49737 |
| 4Glia | 168 | 8,61931 |
| 4I9Yx | 186 | 5,17078 |
| 4IaFj | 132 | 6,02149 |
| 4KJPt | 164 | 9,47551 |
| 4KJTm | 125 | 9,37101 |
| 4KJYT | 164 | 9,45476 |
| 4KNi0 | 164 | 9,45476 |
| 4QHQN | 175 | 9,25619 |
| 4UbA8 | 146 | 9,43187 |
| 4cC2j | 144 | 4,83611 |
| 4dLTz | 164 | 9,52142 |
| 4dNRE | 154 | 5,38682 |
| 4eGFC | 163 | 9,46952 |
| 4f7WG | 145 | 9,54301 |
| 4g5Pw | 143 | 9,02269 |
| 4gJFu | 145 | 9,61116 |
| 4gJYZ | 174 | 9,33530 |
| 4gJrL | 166 | 9,11836 |
| 4kKtH | 164 | 9,54011 |
| 4kRZH | 168 | 9,29642 |
| 4kTVq | 229 | 7,71234 |
| 5GCBk | 133 | 5,69609 |
| 5IYQl | 194 | 9,64565 |
| 5IhcI | 132 | 5,62310 |
| 5JqA2 | 145 | 5,26422 |
| 5hOru | 163 | 9,46894 |
| 5hUyO | 152 | 9,85678 |
| 5iOf | 147 | 5,18863 |
| 6HTWg | 146 | 5,05278 |
| 6Kaqu | 165 | 9,49253 |
| 6MWx5 | 153 | 6,97115 |
| 6PyoH | 183 | 7,88353 |
| 6QNXK | 143 | 6,16876 |
| 6TzEp | 167 | 6,64189 |
| 6VCnQ | 160 | 7,77896 |
| 6VHu4 | 159 | 8,79183 |
| 6VMAp | 161 | 8,81439 |
| 6Wtnq | 174 | 6,58562 |
| 6XC5K | 203 | 5,05409 |
| 6yyMc | 170 | 5,63658 |
| 72AEv | 162 | 9,23705 |
| 7A0B1 | 211 | 9,74712 |
| 7BPJY | 269 | 9,29468 |
| 7Cl6Q | 175 | 5,64959 |
| 7FUOI | 169 | 9,47526 |
| 7KxVJ | 166 | 8,70911 |
| 7dA3n | 146 | 10,00970 |
| 7pF6M | 196 | 8,58843 |
| 7sukw | 141 | 6,94359 |
| 7wdug | 175 | 9,78367 |
| 7ydmb | 178 | 8,99948 |
| 81fF5 | 166 | 8,77042 |
| 83YQf | 178 | 8,92560 |
| 86TvR | 147 | 4,86891 |
| 87t5N | 164 | 9,11597 |
| 8Ac4K | 189 | 6,84327 |
| 8BW1j | 147 | 9,51213 |
| 8LF11 | 211 | 9,71128 |
| 8LpFX | 212 | 8,97866 |
| 8LpV5 | 203 | 9,40589 |
| 8MWFw | 212 | 9,19172 |
| 8MWLd | 213 | 9,38745 |
| 8eKlf | 175 | 9,25007 |
| 8hpgX | 168 | 5,05716 |
| 8iPzZ | 175 | 9,63282 |
| 8jTPM | 204 | 9,66692 |
| 8jbU | 157 | 9,41408 |
| 8jhLY | 188 | 9,02733 |
| 8jo59 | 141 | 9,23834 |
| 8jwOh | 191 | 6,51820 |
| 8m0RW | 132 | 5,88593 |
| 8z4iF | 147 | 9,47854 |
| PTXq | 148 | 8,43886 |
| b4mp | 167 | 8,89826 |
| fDt2 | 176 | 8,32604 |
| ffN | 203 | 9,27592 |
| hq2v | 166 | 9,59485 |
| mbPV | 145 | 4,35014 |
| unu2 | 145 | 9,60439 |
| wH1Q | 148 | 9,12635 |
| V5YSX1 | 168 | 8,66489 |
| A0AAX4QK48 | 197 | 9,68104 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_28113
7zmZV
|
50 | 50,0% | 174 | 1.685E-58 |
| 2 |
phalp2_4451
31DIk
|
4919 | 50,2% | 175 | 3.942E-57 |
| 3 |
phalp2_2632
6RhYr
|
14867 | 51,7% | 172 | 9.223E-56 |
| 4 |
phalp2_33221
5jbqV
|
447 | 48,5% | 175 | 5.553E-54 |
| 5 |
phalp2_6830
8n5Jv
|
121 | 48,2% | 176 | 1.430E-53 |
| 6 |
phalp2_2498
5GMvl
|
297 | 48,2% | 174 | 6.912E-53 |
| 7 |
phalp2_17663
6R9yG
|
6 | 50,8% | 173 | 4.159E-51 |
| 8 |
phalp2_126
5jCCA
|
637 | 46,2% | 175 | 9.717E-50 |
| 9 |
phalp2_4532
3QBcV
|
9 | 48,8% | 170 | 3.427E-49 |
| 10 |
phalp2_37325
8t1Gv
|
89 | 50,8% | 173 | 4.696E-49 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(4OkMH)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50