Protein

Protein accession
1k7XZ [EnVhog]
Representative
8d7ux
Source
EnVhog (cluster: phalp2_14028)
Protein name
1k7XZ
Lysin probability
99%
PhaLP type
endolysin
Probability: 95% (predicted by ML model)
Protein sequence
VTYYEVIKKALLMFYHKDEYAYFYGAKGQRLDDATMNALISAEPSYFAKYTTQELEQIKNYSRGKIGYDCSGFVSEVVGFNNYSTGHYHDGAEKTTPLLGTEGNGLYTTFGGKGRHVGIDIGYGFFLHMPKELHSVTLGRICEYEWEHSFHFANIDYKGAKA
Physico‐chemical
properties
protein length:162 AA
molecular weight:18380,4 Da
isoelectric point:6,24
hydropathy:-0,44
Representative Protein Details
Accession
8d7ux
Protein name
8d7ux
Sequence length
184 AA
Molecular weight
21013,40640 Da
Isoelectric point
5,71354
Sequence
MTGNEVSEKALKMYNERSNYAYLYGAKGEFGNEENITRIIKTWNSYFKKYSKEEIEKIKNFCLGKTLFDCSGFVCEILGAPDYNSATIIAKCNGTKVSDWGLDGKGTPGTLFWKSGHIGINRGDGTFLHMPTELHTIDVGKVSEYDWNVCGKWPNVEYSSNSSEIDYKKFYEEMSEIFNKYKEV
Other Proteins in cluster: phalp2_14028
Total (incl. this protein): 178 Avg length: 161,2 Avg pI: 7,51

Protein ID Length (AA) pI
8d7ux 184 5,71354
1Hr7b 179 5,26979
21qyg 164 8,60326
2335t 180 5,68966
23Ak4 162 7,69494
23HpX 180 5,50693
23MmJ 162 8,57612
23aQ2 200 6,31665
23sjP 162 8,57547
24rJn 161 4,96013
24rwU 167 6,89357
2lTrz 158 8,71202
2lWJr 158 8,70325
38P9s 163 7,78831
3B691 158 8,51017
3KNyA 158 8,50256
3TGQt 168 9,09696
3TIIP 160 7,03663
3TO1C 160 8,95687
3WM7V 160 8,71646
3dUo3 163 8,52383
3e3Gv 172 8,23308
3fV5e 175 6,88482
3gWrB 162 6,06702
3ixzF 185 9,27005
3lgso 159 8,70338
3pwTw 194 5,92117
3rWAh 158 8,70325
3saJA 158 8,71202
3tAIJ 158 8,70325
3tsNJ 162 6,04019
3xNgX 158 9,04603
3yp7g 158 8,50262
3yzz0 158 8,70370
41bv3 160 5,78288
41g1k 152 8,23340
4yoMB 159 5,65812
4ypgE 161 5,90935
5KQu7 159 7,58092
5Kxbu 158 8,71189
5LCTz 159 7,58121
5LWKz 158 8,86332
5MHfs 162 5,94657
5MJJ0 162 6,14148
5MRq0 162 5,94657
5NAlH 158 8,70325
5NFnt 162 6,04013
5OF6z 162 6,04019
5OF83 162 5,86677
5P9LM 162 6,81041
5PeHf 158 8,69480
5SMD8 162 5,86677
5T502 158 8,49508
5T504 161 8,18924
5ToRf 158 8,70363
5TyOC 158 8,72994
5Ugph 162 5,95004
5V2eG 159 8,25513
5V63C 162 5,85393
5VTRt 158 8,99548
5Vvx9 158 8,86345
5WGDO 158 8,86332
5WVzJ 161 8,18924
5XHZo 161 8,69519
5XjPD 158 8,71202
5Y7D4 158 8,86352
5YE13 159 8,19550
5YuI9 159 8,66167
5ZFzt 158 8,70325
5ZlCz 159 8,19556
603KS 162 6,43175
604sr 162 5,86166
608kB 166 8,93675
608lq 159 8,48773
60R7V 162 6,04019
60s2V 162 6,04019
60s46 162 6,03752
61naF 162 5,75867
62Ak8 162 6,43454
62ufp 158 8,69474
62y4Z 158 8,50262
63Kch 158 8,86326
63Z0H 162 5,87041
64D8Z 162 5,87041
64LNR 162 6,03752
64LY9 158 8,50269
64QrH 158 8,50256
64nBw 158 8,84443
65J0Q 162 6,04019
661eI 159 8,86365
67GvV 159 5,91941
67g2u 162 6,04019
67g41 162 6,04019
68HFj 162 5,86677
68iQx 157 8,71202
68nh6 159 8,85378
68nhk 159 8,18931
699Mc 158 8,49514
69dAj 162 5,69569
6aMQK 162 6,04019
6aNUN 159 8,50262
6aNV2 158 8,71208
6aoys 162 6,04019
6bBBJ 162 6,21798
6bTYW 159 6,81553
6bchH 159 8,87319
6bvCG 161 5,73576
6cGBk 158 8,50340
6cLvz 158 8,48863
6cijJ 161 8,44628
6cmaY 162 5,86677
6d4So 163 8,63137
6eEci 159 8,56574
6fIPP 162 5,87405
6g99p 158 8,72117
6gZZI 158 8,70325
6gjrK 162 6,04019
6h3M5 162 5,76219
6jOKG 158 9,09747
6jhh6 158 8,70318
6jlEM 158 8,70325
6kQB4 158 8,87332
6kYNN 162 5,52921
6lHyY 159 8,85372
6lHyx 158 8,50262
6m1es 162 5,52921
6m5Qg 158 8,20181
6m9Ih 162 5,87041
6nABn 158 7,58666
6p9FG 162 6,43306
6q5HO 158 8,86332
6qICB 162 5,94657
6qNbN 159 8,50262
6qNcW 159 8,20201
6qiCV 162 5,58116
6r77N 158 8,71202
6rTMm 158 8,66934
6sOyX 162 6,14642
6t4Zv 162 6,04013
6t8TY 159 8,70338
6tQQI 162 6,03485
6ttZ2 162 5,76702
6tx75 159 8,85378
6uoHh 159 8,20175
6v1FH 159 6,18371
6vABW 162 6,15893
6vOtC 158 8,51797
6wFxH 159 8,19562
6wKu6 158 8,87325
6whcw 159 8,85359
6wm7y 159 8,18931
7WD8I 158 8,71202
7WEwc 158 8,45982
7XCyG 162 6,03485
7XxAm 162 5,94413
7YC7M 162 5,60259
7YxAC 159 8,54852
80qWF 162 9,02282
81ySk 162 6,03752
84gnQ 162 5,43622
85gKU 159 8,87319
86jNy 162 7,61099
87RgY 162 8,78248
88oFq 162 5,94413
8dUVC 162 5,95351
8mYWm 162 6,04019
8mlmC 162 5,94765
8nF9i 122 8,94971
8qPCC 162 5,59594
8r5ac 158 9,01805
8rAOP 162 6,04195
8rMN0 162 8,62634
8s18l 174 8,37059
CVL2 158 8,85378
K11a 158 8,86326
NcZi 159 8,48773
q8wL 159 8,81407
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_29720
1kB9N
9 33,3% 132 1.742E-38
2 phalp2_7255
3TNPU
22 27,1% 173 4.032E-31
3 phalp2_870
8brVc
9 33,8% 121 3.936E-15
4 phalp2_11216
6pi59
34 26,2% 145 2.514E-14
5 phalp2_23391
5URxG
99 21,4% 149 5.498E-11
6 phalp2_37173
1LCVC
1 26,6% 150 8.610E-10
7 phalp2_39783
o9Wk
1 23,3% 163 1.333E-08
8 phalp2_4327
8rHwf
3 20,5% 151 6.072E-08
9 phalp2_5115
1NAmt
1 24,0% 150 1.505E-07
10 phalp2_32200
6Xp2c
36 22,0% 159 7.535E-06

Domains

Domains
Unannotated
Representative sequence (used for alignment): 8d7ux (184 AA)
Member sequence: 1k7XZ (162 AA)
1 184 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (8d7ux) rather than this protein.
PDB ID
8d7ux
Method AlphaFoldv2
Resolution 88.53
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50