Protein
- Protein accession
- 1iDHP [EnVhog]
- Representative
- 4aDQQ
- Source
- EnVhog (cluster: phalp2_5594)
- Protein name
- 1iDHP
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 97% (predicted by ML model) - Protein sequence
-
THPITGKKRLHTGVDIVTGRANTAIIAPEAGIVLEARKSTAPGGGYGWFVKYRGFSGAVHLMAHLVEGSIAVKTGQAIIQGQKLGVMGTTGASTGVHLHWEVRGKVPVDPIKWMAKQNA
- Physico‐chemical
properties -
protein length: 119 AA molecular weight: 12518,4 Da isoelectric point: 10,23 hydropathy: -0,01
Representative Protein Details
- Accession
- 4aDQQ
- Protein name
- 4aDQQ
- Sequence length
- 144 AA
- Molecular weight
- 15746,82900 Da
- Isoelectric point
- 9,72842
- Sequence
-
MRFPFDKPVPKISSGYGWRIHPIEKIRKHHNGVDYAGALGTPVRAIADGKVIFAGASTLKFSNGEPAGGGYLVKIRHKVNGKWITSAYMHMVKGSIAVKKGQDVIEGQVIGKLGNTGESTGPHLHFEIQEGKDYVWTSNGTRYE
Other Proteins in cluster: phalp2_5594
| Total (incl. this protein): 125 | Avg length: 163,3 | Avg pI: 8,65 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 4aDQQ | 144 | 9,72842 |
| 1LCjf | 161 | 10,03046 |
| 1Ldns | 161 | 9,83518 |
| 1MCPN | 156 | 9,82074 |
| 1MLBb | 158 | 9,59356 |
| 1c4uM | 131 | 6,27715 |
| 1cToF | 190 | 6,93518 |
| 1dUWB | 180 | 9,87096 |
| 20xz9 | 156 | 9,82094 |
| 21GTS | 190 | 6,63166 |
| 21llM | 188 | 5,91492 |
| 21x2f | 200 | 6,03661 |
| 23IlD | 187 | 8,93334 |
| 23KGU | 191 | 8,57979 |
| 2GENT | 170 | 9,60606 |
| 2Zx6Y | 156 | 9,82094 |
| 2fX2G | 224 | 4,90187 |
| 37mlD | 140 | 10,25713 |
| 38g1Z | 145 | 10,11530 |
| 3TCGj | 191 | 6,63921 |
| 3V3Kp | 198 | 5,48072 |
| 3V3Y5 | 118 | 4,48769 |
| 3VIyP | 197 | 8,22180 |
| 3WANO | 193 | 6,02751 |
| 3WBMn | 197 | 8,54459 |
| 3WFQK | 188 | 6,01387 |
| 3WJOw | 196 | 6,35394 |
| 3aqmO | 160 | 6,49376 |
| 3bYKk | 195 | 7,66510 |
| 3dRLn | 182 | 6,99912 |
| 3drRn | 142 | 10,27944 |
| 3e22t | 189 | 5,80306 |
| 3h4en | 187 | 6,35400 |
| 3mTfl | 119 | 6,27078 |
| 3tSio | 177 | 8,58592 |
| 3vUI6 | 189 | 9,24981 |
| 3wk7P | 189 | 7,68136 |
| 3yVWH | 190 | 6,99315 |
| 3yWnk | 149 | 8,62008 |
| 40ZSs | 201 | 8,26190 |
| 41Fpn | 142 | 10,35602 |
| 41PSG | 139 | 10,03529 |
| 41Yfx | 143 | 10,47568 |
| 41o6R | 184 | 7,00725 |
| 45aGG | 139 | 8,22277 |
| 49ACo | 156 | 9,82094 |
| 49AE5 | 164 | 9,65345 |
| 49SvU | 139 | 10,36112 |
| 49rHf | 157 | 10,07997 |
| 4AebB | 139 | 10,28401 |
| 4BRqC | 140 | 10,42043 |
| 4BYFp | 140 | 10,35345 |
| 4KKyU | 163 | 10,09699 |
| 4KT7s | 156 | 10,14109 |
| 4Ko2k | 156 | 10,36389 |
| 4NHBm | 138 | 10,44273 |
| 4NHNS | 142 | 10,39213 |
| 4NJmZ | 140 | 10,07552 |
| 4RrmZ | 156 | 10,20968 |
| 4Ytos | 133 | 9,75511 |
| 4acqU | 156 | 10,06688 |
| 4bsIX | 156 | 9,79367 |
| 4bsf5 | 156 | 9,99397 |
| 4bt1F | 161 | 9,74783 |
| 4kCve | 139 | 6,57482 |
| 4l5ts | 156 | 9,79367 |
| 4ppVA | 156 | 9,79367 |
| 58puw | 139 | 10,36376 |
| 5Ca4f | 138 | 10,35854 |
| 5KAa0 | 196 | 8,27363 |
| 5PJU8 | 190 | 7,03692 |
| 5WjgF | 196 | 8,16784 |
| 5YuID | 199 | 8,79202 |
| 5daHn | 140 | 10,47207 |
| 5eIn1 | 123 | 10,24778 |
| 5eZLg | 156 | 9,79367 |
| 5gfz9 | 156 | 9,86265 |
| 5hkhi | 140 | 10,35854 |
| 5hr4P | 138 | 10,40354 |
| 5i53k | 131 | 6,92415 |
| 5icUw | 156 | 9,86265 |
| 5lAk3 | 144 | 10,51391 |
| 5mIF | 187 | 6,56902 |
| 5xxhR | 156 | 10,12761 |
| 60Cej | 195 | 7,03481 |
| 62OIC | 193 | 7,59712 |
| 64xAu | 188 | 6,20099 |
| 67Ko9 | 185 | 5,25359 |
| 67UcD | 190 | 6,41868 |
| 6GgCQ | 145 | 10,00035 |
| 6IABv | 108 | 9,92679 |
| 6Is59 | 141 | 10,04064 |
| 6KSDl | 144 | 10,08758 |
| 6KVzY | 140 | 10,13213 |
| 6Tly1 | 130 | 4,70402 |
| 6Ur3k | 145 | 10,32076 |
| 6awz8 | 196 | 6,63859 |
| 6g14P | 196 | 8,96557 |
| 6m5QE | 195 | 7,03561 |
| 6p0oW | 196 | 6,36008 |
| 6qX7Y | 188 | 6,26874 |
| 6rJOJ | 192 | 8,24236 |
| 6sWxI | 195 | 8,24223 |
| 6uNvV | 203 | 9,53167 |
| 6x8oB | 156 | 9,79302 |
| 6xs5x | 144 | 10,08758 |
| 6ycpP | 156 | 9,85001 |
| 71zIQ | 202 | 5,46430 |
| 7hpWU | 136 | 7,19209 |
| 82FXF | 208 | 7,62963 |
| 82GcE | 187 | 9,39061 |
| 82Hto | 186 | 7,81101 |
| 83H4l | 199 | 8,80356 |
| 85FnY | 140 | 9,89791 |
| FNXV | 163 | 9,81423 |
| J9wg | 140 | 9,95032 |
| a4mz | 188 | 6,11937 |
| bsYm | 160 | 9,75486 |
| c5SU | 156 | 9,82094 |
| ftaf | 147 | 5,27917 |
| A0A6J5LW88 | 145 | 10,07185 |
| A0A6J5MQD6 | 86 | 9,69793 |
| A0A6J5N096 | 69 | 9,77452 |
| A0A6J5N0U5 | 156 | 9,99474 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_36747
6BM9K
|
381 | 57,6% | 144 | 1.277E-56 |
| 2 |
phalp2_14848
7w0BH
|
74 | 39,2% | 140 | 2.320E-32 |
| 3 |
phalp2_29748
1xSNS
|
1 | 58,6% | 87 | 5.975E-32 |
| 4 |
phalp2_5756
7Czmx
|
45 | 44,4% | 117 | 7.444E-31 |
| 5 |
phalp2_19030
17y4D
|
9 | 39,6% | 131 | 4.070E-28 |
| 6 |
phalp2_24228
2SnS7
|
7 | 39,5% | 129 | 7.643E-28 |
| 7 |
phalp2_5933
67ENK
|
29 | 32,3% | 139 | 3.038E-25 |
| 8 |
phalp2_532
pOAI
|
4 | 39,0% | 123 | 5.704E-25 |
| 9 |
phalp2_34915
4pbkX
|
159 | 35,0% | 137 | 2.010E-24 |
| 10 |
phalp2_31190
87Snf
|
9 | 35,5% | 118 | 1.820E-23 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(4aDQQ)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50