Protein

Protein accession
1hVmJ [EnVhog]
Representative
5C68a
Source
EnVhog (cluster: phalp2_180)
Protein name
1hVmJ
Lysin probability
92%
PhaLP type
endolysin
Probability: 98% (predicted by ML model)
Protein sequence
MGKVKQKINKEVSNAVVSVKKWTKRILGIGLLFGSIYLVGTFHPNNYILHKYEKEFENKYLDKLKELDLREPAFEFNNDMQFVRAVHKCIDYLNFTTPSHNRVPYEMVTAQAVLESAWGNSRFAEKANNLFGIRVFKTTQPHMLPEGMEKWPGWGVRVFATKCDSVKEYIRLMNEHPAYERFRKLRIKQLSLYGKMDPIELVKTLDKFSTTPDYPERVIRIIKKIRKLEEQM
Physico‐chemical
properties
protein length:232 AA
molecular weight:27366,6 Da
isoelectric point:9,61
hydropathy:-0,49
Representative Protein Details
Accession
5C68a
Protein name
5C68a
Sequence length
127 AA
Molecular weight
14625,82700 Da
Isoelectric point
9,62611
Sequence
MLIKYLIVALLAFVLGTFFPNPVAKKKTEDATIAWAKSLGFGPPRFDYSNDQEFISSLNKCIQYLNYTIPRPQRINSELIIAQAIVESNYGKSRFAREGNNLFGIRIWSKNGMLPLKQPEEIEWRVR
Other Proteins in cluster: phalp2_180
Total (incl. this protein): 119 Avg length: 209,9 Avg pI: 9,37

Protein ID Length (AA) pI
5C68a 127 9,62611
10OXC 227 9,41337
112v5 226 9,49975
14hiZ 245 9,37926
1BS38 139 9,51761
1Bg1v 225 9,48757
1O2X9 137 9,80179
1OUuR 109 9,44831
1Pcl 227 9,35960
1RFpq 143 9,84776
1RY74 228 9,72256
1Rm0p 227 9,29997
1S4eN 221 8,66051
1SBgb 226 9,27096
1TIpd 227 9,28746
1TZQP 221 9,13499
1TsVY 226 9,39409
1UGio 226 9,54907
1UTfr 220 8,85075
1V11U 225 9,54869
1VLm1 227 9,54862
1VoNB 227 9,51813
1Vzkr 237 9,42175
1WbOt 226 9,59278
1WqjZ 227 9,35109
1Z8eP 230 9,79676
1fj5I 226 9,59259
1grKw 227 9,21087
1iCdA 130 9,20462
1rAoE 226 9,61683
1t4tG 238 9,62843
1t6Ql 238 9,59020
1tViJ 228 9,31376
1uhpY 238 9,48738
1vU7S 229 9,54778
1xFn4 229 9,54778
1xJpp 226 9,54611
1yrDh 220 9,40067
1zWFl 147 9,89076
1zst 228 9,60600
1ztUA 238 9,62843
22eDU 165 9,59762
25Ow 225 9,68820
2678K 257 9,25993
26fxI 225 9,59278
27a7A 244 9,42497
29Oh7 253 8,88505
2APv2 220 9,36585
2AtU2 220 8,86493
2IG7d 183 9,51639
2LaZ3 140 8,68081
2MJPO 257 9,32808
2QLSt 220 9,40125
2TRBK 243 9,66338
2U0vZ 227 9,56132
2Xyqi 136 9,51310
2a2NX 257 9,25993
2akdz 242 9,67930
2f5Z4 234 9,53238
2nHc7 226 9,57667
2nim4 220 9,38010
2q2BB 219 9,62244
2qO4W 227 9,45140
2xgqL 229 9,40911
2zffZ 223 9,46120
32JzN 227 9,41337
368J0 225 9,49975
36dbM 219 9,13473
36e4D 228 9,19089
3CsGN 221 8,36775
3J76c 234 9,07110
3Z91b 234 9,63288
3cD2q 233 9,40028
3cVfI 195 9,75054
3jex0 227 9,48383
46g2e 157 9,46159
48jh7 120 9,23930
4D2Qr 228 9,42497
4Jfg7 225 9,68820
4QLsX 229 9,37855
4WTFY 221 8,67121
4WTJ9 164 7,74524
4gWGQ 166 9,16549
4wwYU 223 9,32447
4zadM 128 9,41047
59t0U 132 9,86033
5EnWI 134 9,75634
5Ezfm 186 9,79147
5ImHQ 225 9,61683
5fb6N 112 9,51755
5hMdt 92 9,60987
5shBT 142 9,09773
5ymo7 95 9,67311
6OIKX 227 9,50233
7CSpp 221 8,87370
7EeZp 226 9,67014
823XX 130 6,57948
83Peb 220 9,25245
84jWv 312 6,97996
85KXo 226 9,41466
8EDtj 226 9,51716
8EzYd 223 9,53283
8F8Mn 169 9,54656
8c3l4 228 9,46855
8qcYI 219 9,27083
8xeap 226 9,61683
8yN2o 229 9,47016
WGDq 221 9,44070
WhL9 229 9,45076
XPRW 229 9,37249
YmKS 221 9,14840
Z5An 152 9,09728
ic3W 226 9,44547
kFRJ 240 9,57473
kmLw 240 9,62818
koLD 240 9,62818
lXTT 227 9,57854
tSff 227 9,43658
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_31741
3UUHU
3 40,0% 85 6.778E-31
2 phalp2_13240
2ZYO6
4 44,9% 89 1.595E-29

Domains

Domains
Representative sequence (used for alignment): 5C68a (127 AA)
Member sequence: 1hVmJ (232 AA)
1 127 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01832

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (5C68a) rather than this protein.
PDB ID
5C68a
Method AlphaFoldv2
Resolution 94.38
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50